8pw7

A respirasome from murine liver

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain n； PDBConstruct 1–514； UniProt 1–514

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P00405

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain o； PDBConstruct 1–227； UniProt 1–227

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00416

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain p； PDBConstruct 1–261； UniProt 1–261

Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

OrganismNot specified

UniProt P19783

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX41_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain q； PDBConstruct 1–169； UniProt 1–169

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P12787

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain r； PDBConstruct 1–146； UniProt 1–146

Cytochrome c oxidase subunit 5B, mitochondrial

OrganismNot specified

UniProt P19536

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5B_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain s； PDBConstruct 1–128； UniProt 1–128

Cytochrome c oxidase subunit 6A1, mitochondrial

OrganismNot specified

UniProt P43024

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6A1_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain t； PDBConstruct 1–111； UniProt 1–111

Cytochrome c oxidase subunit 6B1

OrganismNot specified

UniProt P56391

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6B1_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain u； PDBConstruct 1–86； UniProt 1–86

Cytochrome c oxidase subunit 6C

OrganismNot specified

UniProt Q9CPQ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6C_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain v； PDBConstruct 1–76； UniProt 1–76

Cytochrome c oxidase subunit 7B, mitochondrial

OrganismNot specified

UniProt P56393

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7B_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain x； PDBConstruct 1–80； UniProt 1–80

Cytochrome c oxidase subunit 7C, mitochondrial

OrganismNot specified

UniProt P17665

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7C_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain y； PDBConstruct 1–63； UniProt 1–63

Cytochrome c oxidase subunit 7A2, mitochondrial

OrganismNot specified

UniProt P48771

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX7A2_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain w； PDBConstruct 1–83； UniProt 1–83

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

UniProt Q9CZ13

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain A； PDBConstruct 1–480； UniProt 1–480 Author chain L； PDBConstruct 1–480； UniProt 1–480

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt Q9DB77

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain B； PDBConstruct 1–453； UniProt 1–453 Author chain M； PDBConstruct 1–453； UniProt 1–453

Cytochrome b

OrganismNot specified

UniProt P00158

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain C； PDBConstruct 1–381； UniProt 1–381 Author chain N； PDBConstruct 1–381； UniProt 1–381

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt Q9D0M3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain D； PDBConstruct 1–325； UniProt 1–325 Author chain O； PDBConstruct 1–325； UniProt 1–325

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt Q9CR68

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain E； PDBConstruct 1–274； UniProt 1–274 Author chain P； PDBConstruct 1–274； UniProt 1–274 Author chain T； PDBConstruct 1–274； UniProt 1–274

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt Q9CQB4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9CQB4_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain F； PDBConstruct 1–111； UniProt 1–111 Author chain Q； PDBConstruct 1–111； UniProt 1–111

Cytochrome b-c1 complex subunit 8

OrganismNot specified

UniProt Q9CQ69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain G； PDBConstruct 1–82； UniProt 1–82 Author chain R； PDBConstruct 1–82； UniProt 1–82

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P99028

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain H； PDBConstruct 1–89； UniProt 1–89 Author chain S； PDBConstruct 1–89； UniProt 1–89

Cytochrome b-c1 complex subunit 9

OrganismNot specified

UniProt Q8R1I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain J； PDBConstruct 1–64； UniProt 1–64 Author chain U； PDBConstruct 1–64； UniProt 1–64

Cytochrome b-c1 complex subunit 10

OrganismNot specified

UniProt Q9CPX8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain K； PDBConstruct 1–56； UniProt 1–56 Author chain V； PDBConstruct 1–56； UniProt 1–56

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

OrganismNot specified

UniProt Q9DC70

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS7_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain 6； PDBConstruct 1–224； UniProt 1–224

NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

OrganismNot specified

UniProt Q9DCT2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS3_MOUSE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain C1； PDBConstruct 1–263； UniProt 1–263

NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

OrganismNot specified

UniProt Q91WD5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS2_MOUSE
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain D1； PDBConstruct 1–463； UniProt 1–463

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

OrganismNot specified

UniProt Q9D6J6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV2_MOUSE
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain 2； PDBConstruct 1–248； UniProt 1–248

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

OrganismNot specified

UniProt Q91YT0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV1_MOUSE
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain 1； PDBConstruct 1–464； UniProt 1–464

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

OrganismNot specified

UniProt Q91VD9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS1_MOUSE
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain 3； PDBConstruct 1–727； UniProt 1–727

NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

OrganismNot specified

UniProt Q8K3J1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS8_MOUSE
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain 9； PDBConstruct 1–212； UniProt 1–212

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

OrganismNot specified

UniProt Q9DC69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA9_MOUSE
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain P1； PDBConstruct 1–377； UniProt 1–377

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

OrganismNot specified

UniProt Q9CXZ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS4_MOUSE
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain Q1； PDBConstruct 1–175； UniProt 1–175

NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

OrganismNot specified

UniProt P52503

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS6_MOUSE
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain 7； PDBConstruct 1–116； UniProt 1–116

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

OrganismNot specified

UniProt Q9CQ75

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA2_MOUSE
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain S1； PDBConstruct 1–99； UniProt 1–99

Acyl carrier protein, mitochondrial

OrganismNot specified

UniProt Q9CR21

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_MOUSE
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain T1； PDBConstruct 1–156； UniProt 1–156 Author chain U1； PDBConstruct 1–156； UniProt 1–156

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

OrganismNot specified

UniProt Q9CPP6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA5_MOUSE
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain V1； PDBConstruct 1–116； UniProt 1–116

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

OrganismNot specified

UniProt Q9CQZ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA6_MOUSE
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain W1； PDBConstruct 1–131； UniProt 1–131

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

OrganismNot specified

UniProt Q7TMF3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAC_MOUSE
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain q1； PDBConstruct 1–145； UniProt 1–145

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7

OrganismNot specified

UniProt Q9Z1P6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA7_MOUSE
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain r1； PDBConstruct 1–113； UniProt 1–113

NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

OrganismNot specified

UniProt Q8BK30

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV3_MOUSE
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain s1； PDBConstruct 1–104； UniProt 1–104

NADH-ubiquinone oxidoreductase chain 3

OrganismNot specified

UniProt P03899

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3M_MOUSE
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain A1； PDBConstruct 1–115； UniProt 1–115

NADH-ubiquinone oxidoreductase chain 1

OrganismNot specified

UniProt P03888

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1M_MOUSE
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain H1； PDBConstruct 1–318； UniProt 1–318

NADH-ubiquinone oxidoreductase chain 6

OrganismNot specified

UniProt P03925

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU6M_MOUSE
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain J1； PDBConstruct 1–172； UniProt 1–172

NADH-ubiquinone oxidoreductase chain 4L

OrganismNot specified

UniProt P03903

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4LM_MOUSE
Isoform	—
PDB entities	43
Chains and sequence ranges	Author chain K1； PDBConstruct 1–98； UniProt 1–98

NADH-ubiquinone oxidoreductase chain 5

OrganismNot specified

UniProt P03921

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU5M_MOUSE
Isoform	—
PDB entities	44
Chains and sequence ranges	Author chain L1； PDBConstruct 1–607； UniProt 1–607

NADH-ubiquinone oxidoreductase chain 4

OrganismNot specified

UniProt P03911

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU4M_MOUSE
Isoform	—
PDB entities	45
Chains and sequence ranges	Author chain M1； PDBConstruct 1–459； UniProt 1–459

NADH-ubiquinone oxidoreductase chain 2

OrganismNot specified

UniProt P03893

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU2M_MOUSE
Isoform	—
PDB entities	46
Chains and sequence ranges	Author chain N1； PDBConstruct 1–345； UniProt 1–345

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial

OrganismNot specified

UniProt Q99LC3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAA_MOUSE
Isoform	—
PDB entities	47
Chains and sequence ranges	Author chain O1； PDBConstruct 1–355； UniProt 1–355

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

OrganismNot specified

UniProt Q9DCJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA8_MOUSE
Isoform	—
PDB entities	48
Chains and sequence ranges	Author chain X1； PDBConstruct 1–172； UniProt 1–172

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11

OrganismNot specified

UniProt G5E814

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G5E814_MOUSE
Isoform	—
PDB entities	49
Chains and sequence ranges	Author chain Y1； PDBConstruct 1–141； UniProt 3–143

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

OrganismNot specified

UniProt Q9ERS2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAD_MOUSE
Isoform	—
PDB entities	50
Chains and sequence ranges	Author chain Z1； PDBConstruct 1–144； UniProt 1–144

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1

OrganismNot specified

UniProt O35683

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA1_MOUSE
Isoform	—
PDB entities	51
Chains and sequence ranges	Author chain a1； PDBConstruct 1–70； UniProt 1–70

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3

OrganismNot specified

UniProt Q9CQ91

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA3_MOUSE
Isoform	—
PDB entities	52
Chains and sequence ranges	Author chain b1； PDBConstruct 1–84； UniProt 1–84

NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial

OrganismNot specified

UniProt Q9CQY9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUC1_MOUSE
Isoform	—
PDB entities	53
Chains and sequence ranges	Author chain c1； PDBConstruct 1–76； UniProt 1–76

NADH dehydrogenase [ubiquinone] 1 subunit C2

OrganismNot specified

UniProt Q9CQ54

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUC2_MOUSE
Isoform	—
PDB entities	54
Chains and sequence ranges	Author chain d1； PDBConstruct 1–120； UniProt 1–120

NADH dehydrogenase [ubiquinone] iron-sulfur protein 5

OrganismNot specified

UniProt Q99LY9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS5_MOUSE
Isoform	—
PDB entities	55
Chains and sequence ranges	Author chain e1； PDBConstruct 1–106； UniProt 1–106

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1

OrganismNot specified

UniProt P0DN34

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB1_MOUSE
Isoform	—
PDB entities	56
Chains and sequence ranges	Author chain f1； PDBConstruct 1–57； UniProt 1–57

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial

OrganismNot specified

UniProt O09111

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUBB_MOUSE
Isoform	—
PDB entities	57
Chains and sequence ranges	Author chain g1； PDBConstruct 1–151； UniProt 1–151

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial

OrganismNot specified

UniProt Q9CQH3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB5_MOUSE
Isoform	—
PDB entities	58
Chains and sequence ranges	Author chain h1； PDBConstruct 1–189； UniProt 1–189

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

OrganismNot specified

UniProt Q3UIU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB6_MOUSE
Isoform	—
PDB entities	59
Chains and sequence ranges	Author chain i1； PDBConstruct 1–128； UniProt 1–128

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial

OrganismNot specified

UniProt Q9CPU2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB2_MOUSE
Isoform	—
PDB entities	60
Chains and sequence ranges	Author chain j1； PDBConstruct 1–105； UniProt 1–105

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3

OrganismNot specified

UniProt Q9CQZ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB3_MOUSE
Isoform	—
PDB entities	61
Chains and sequence ranges	Author chain k1； PDBConstruct 1–104； UniProt 1–104

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial

OrganismNot specified

UniProt Q9D6J5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB8_MOUSE
Isoform	—
PDB entities	62
Chains and sequence ranges	Author chain l1； PDBConstruct 1–186； UniProt 1–186

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4

OrganismNot specified

UniProt Q9CQC7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB4_MOUSE
Isoform	—
PDB entities	63
Chains and sequence ranges	Author chain m1； PDBConstruct 1–129； UniProt 1–129

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9

OrganismNot specified

UniProt Q9CQJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB9_MOUSE
Isoform	—
PDB entities	64
Chains and sequence ranges	Author chain n1； PDBConstruct 1–179； UniProt 1–179

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

OrganismNot specified

UniProt Q9CR61

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUB7_MOUSE
Isoform	—
PDB entities	65
Chains and sequence ranges	Author chain o1； PDBConstruct 1–137； UniProt 1–137

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10

OrganismNot specified

UniProt Q9DCS9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） Cytochrome c oxidase subunit 8A, mitochondrial × 1 （Q64445） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUBA_MOUSE
Isoform	—
PDB entities	66
Chains and sequence ranges	Author chain p1； PDBConstruct 1–176； UniProt 1–176

Cytochrome c oxidase subunit 8A, mitochondrial

OrganismNot specified

UniProt Q64445

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 79	Cytochrome c oxidase subunit 1 × 1 （P00397） Cytochrome c oxidase subunit 2 × 1 （P00405） Cytochrome c oxidase subunit 3 × 1 （P00416） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 1 （P19783） Cytochrome c oxidase subunit 5A, mitochondrial × 1 （P12787） Cytochrome c oxidase subunit 5B, mitochondrial × 1 （P19536） Cytochrome c oxidase subunit 6A1, mitochondrial × 1 （P43024） Cytochrome c oxidase subunit 6B1 × 1 （P56391） Cytochrome c oxidase subunit 6C × 1 （Q9CPQ1） Cytochrome c oxidase subunit 7B, mitochondrial × 1 （P56393） Cytochrome c oxidase subunit 7C, mitochondrial × 1 （P17665） Cytochrome c oxidase subunit 7A2, mitochondrial × 1 （P48771） Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 2 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH-ubiquinone oxidoreductase chain 6 × 1 （P03925） NADH-ubiquinone oxidoreductase chain 4L × 1 （P03903） NADH-ubiquinone oxidoreductase chain 5 × 1 （P03921） NADH-ubiquinone oxidoreductase chain 4 × 1 （P03911） NADH-ubiquinone oxidoreductase chain 2 × 1 （P03893） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial × 1 （Q99LC3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 × 1 （G5E814） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial × 1 （Q9CQY9） NADH dehydrogenase [ubiquinone] 1 subunit C2 × 1 （Q9CQ54） NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 × 1 （Q99LY9） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 × 1 （P0DN34） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial × 1 （O09111） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial × 1 （Q9CQH3） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 × 1 （Q3UIU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial × 1 （Q9CPU2） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 × 1 （Q9CQZ6） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial × 1 （Q9D6J5） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 × 1 （Q9CQC7） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 × 1 （Q9CQJ8） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7 × 1 （Q9CR61） NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 × 1 （Q9DCS9） COPPER (II) ION × 1 SODIUM ION × 1 HEME-A × 2 1,2-Distearoyl-sn-glycerophosphoethanolamine × 33 MAGNESIUM ION × 2 DINUCLEAR COPPER ION × 1 ZINC ION × 2 TRISTEAROYLGLYCEROL × 1 CARDIOLIPIN × 16 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 4 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 9 IRON/SULFUR CLUSTER × 6 FLAVIN MONONUCLEOTIDE × 1 POTASSIUM ION × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate × 2 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX8A_MOUSE
Isoform	—
PDB entities	67
Chains and sequence ranges	Author chain z； PDBConstruct 1–69； UniProt 1–69

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8pw7
Deposition date deposition_date	2023-07-19
Structure title title	A respirasome from murine liver
Keywords keywords	Respiratory chain super complex, mammalian mitochondria, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8pw7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8pw7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8pw7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	88.89 Å
Rg (electron density)	87.88 Å
Total Rg	87.82 Å
Atom count	115575
Residues	14142
Excluded volume	2082300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8pw7__assembly_1__model_1`	79-meric （79）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (86)

Entity 1 Entity 1 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	56945.6 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n
Atom count atom_count	115575

MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSILIRAELGQPGALLGDDQIYNVIVTAHAFVMIFFMVMPMMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGLDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFSGFTLDDTWAKAHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTVSSMGSFISLTAVLIMIFMIWEAFASKREVMSVSYASTNLEWLHGCPPPYHTFEEPTYVKVK

Entity 2 Entity 2 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	25993.3 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI

Entity 3 Entity 3 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	29948.7 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWAFYHSSLVPTHDLGGCWPPTGISPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGKRNHMNQALLITIMLGLYFTILQASEYFETSFSISDGIYGSTFFMATGFHGLHVIIGSTFLIVCLLRQLKFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS

Entity 4 Entity 4 polymer

Description description	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Molecular weight formula_weight	19558.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MLASRALSLIGKRAISTSVCLRAHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSASQKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTNEWKTVVGMAMFFIGFTALVLIWEKSYVYGPIPHTFDRDWVAMQTKRMLDMKANPIQGFSAKWDYDKNEWKK

Entity 5 Entity 5 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	16123.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MLAAALRRCTAAAAARGLLHPASAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Entity 6 Entity 6 polymer

Description description	Cytochrome c oxidase subunit 5B, mitochondrial
Molecular weight formula_weight	13831.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MASRLLRGVGALAAQALRRTARGAAVTRSMASGGGVPTDEEQATGLEREIMIAAQKGLDPYNMLPPKAASGTKEDPNLVPSISNKRIVGCICEEDNCTVIWFWLHKGESQRCPNCGTHYKLVPHQMAH

Entity 7 Entity 7 polymer

Description description	Cytochrome c oxidase subunit 6A1, mitochondrial
Molecular weight formula_weight	12372.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MASAVLSASRVSRPLGRALPGLRRPMSSGAHGEEGSARMWKALTYFVALPGVGVSMLNVFLKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE

Entity 8 Entity 8 polymer

Description description	Cytochrome c oxidase subunit 6B1
Molecular weight formula_weight	10086.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

MAEDIKTKIKNYKTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPVSWVSAWDDRIAEGTFPGKI

Entity 9 Entity 9 polymer

Description description	Cytochrome c oxidase subunit 6C
Molecular weight formula_weight	8484.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MSSGALLPKPQMRGLLAKRLRVHIAGAFIVALGVAAAYKFGVAEPRKKAYAEFYRNYDSMKDFEEMRKAGIFQSAK

Entity 10 Entity 10 polymer

Description description	Cytochrome c oxidase subunit 7B, mitochondrial
Molecular weight formula_weight	9023.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MLPLAKNALSRLQVRSIQQVVARQSHQKRAPSFHDKYGNAILAGGAIFCVSTWTYTATQIGIEWNMSPVGRVTPKEWRDQ

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase subunit 7C, mitochondrial
Molecular weight formula_weight	7344.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWRLLAMMTVYFGSGFAAPFFIVRHQLLKK

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 7A2, mitochondrial
Molecular weight formula_weight	9304.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MLRNLLALRQIAQRTISTTSRRHFENKVPEKQKLFQEDNGMPVHLKGGASDALLYRATMALTLGGTAYAIYLLAMAAFPKKQN

Entity 13 Entity 13 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	52910.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,L

MAASAVCRAACSGTQVLLRTRRSPALLRLPALRGTATFAQALQSVPETQVSILDNGLRVASEQSSHATCTVGVWIDAGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESIGAHLNAYSTREHTAYLIKALSKDLPKVVELLADIVQNSSLEDSQIEKERDVILREMQENDASMQNVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLNRHYKAPRMVLAAAGGVEHQQLLDLAQKHLSSVSRVYEEDAVPGLTPCRFTGSEIRHRDDALPLAHVAIAVEGPGWANPDNVTLQVANAIIGHYDCTYGGGVHLSSPLASVAVANKLCQSFQTFNISYSDTGLLGAHFVCDAMSIDDMVFFLQGQWMRLCTSATESEVTRGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIQEVDAQMLRDICSKYFYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF

Entity 14 Entity 14 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	48289.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,M

MKLLSRAGSFSRFYSLKVAPKVKTSAAPGGVPLQPQDLEFTKLPNGLVIASLENYAPLSRIGLFVKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVEGIRSDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNSQTRIIENLHDVAYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSVLKQVAEQFLNMRGGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIKRGNNTTSLLSQSVAKGSHQPFDVSAFNASYSDSGLFGIYTISQAAAAGEVINAAYNQVKAVAQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALAAGSYMPPSTVLQQIDSVADADVVKAAKKFVSGKKSMAASGNLGHTPFLDEL

Entity 15 Entity 15 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43240.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,N

MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLYYGSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILMTLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILILALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGGQPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKLYP

Entity 16 Entity 16 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	35374.7 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,O

MAAAAASLRRTVLGPRGVGLPGASAPGLLGGARSRQLPLRTPQAVSLSSKSGPSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPPK

Entity 17 Entity 17 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	29406.6 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,P,T

MLSVAARSGPFAPVLSATSRGVAGALRPLLQGAVPAASEPPVLDVKRPFLCRESLSGQAAARPLVATVGLNVPASVRFSHTDVKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPAYEFTSDDVVVVG

Entity 18 Entity 18 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13587.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,Q

MAGRSAVSASSKWLDGFRKWYYNAAGFNKLGLMRDDTLHETEDVKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERKEREEWAKK

Entity 19 Entity 19 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	9783.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,R

MGREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIYTWGNQEFEQSKRKNPAMYENDK

Entity 20 Entity 20 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	10452.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,S

MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEELFDFLHARDHCVAHKLFKNLK

Entity 21 Entity 21 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7457.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,U

MSSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE

Entity 22 Entity 22 polymer

Description description	Cytochrome b-c1 complex subunit 10
Molecular weight formula_weight	6546.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,V

MLSRFLGPRYRELARNWIPTAGMWGTVGAVGLVWATDWRLILDWVPYINGKFKKDD

Entity 23 Entity 23 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
Molecular weight formula_weight	24715.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

MAALAAPGLLSVRILGLRTAQVQLRRVHQSVATEGPSPSPSPSLSSTQSAVSKAGAGAVVPKLSHLPRSRAEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKREQKLKIWYRR

Entity 24 Entity 24 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
Molecular weight formula_weight	30191.3 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C1

MAAAAARVWCRGLLGAASVGRGAGRPSVLWQHVRRESAAADKRPTVRPRSDVTHKQLSAFGEYVAEILPKYVQQVQVSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFGVFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKPETK

Entity 25 Entity 25 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
Molecular weight formula_weight	52720.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D1

MAALRALRCLRGVGAPVLRPGSGIRLPSQPSRGARQWQPDIEWAEQFSGAVMYPSKETAHWKPPPWNDVDILKEKAVTNMTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSIAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLLDDIYEFSKNFSLRIDEVEEMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSLRIIEQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEIDR

Entity 26 Entity 26 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
Molecular weight formula_weight	27318.3 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MFSLALRARATGLAAQWGRHARNLHKTAVHNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL

Entity 27 Entity 27 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Molecular weight formula_weight	50904.2 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MLAARHFLGGLVPVRVSVRFSSGTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGALRRGDWYKTKEILLKGPDWILGEMKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSDYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQQHRAWQAAS

Entity 28 Entity 28 polymer

Description description	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Molecular weight formula_weight	79866.7 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNVIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAAIAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGRHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC

Entity 29 Entity 29 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
Molecular weight formula_weight	24068.4 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	9

MYRLSSSMLPRALAQAMRTGHLNGQSLHSSAVAATYKYVNKKEQESEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR

Entity 30 Entity 30 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
Molecular weight formula_weight	42588.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P1

MAAAVRFRVVRALPMSRPAITAAATSVFCGSSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDVYDIMHLRLMGDLGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKEAGVERFIHVSHLNASMKSSSKSLRSKAVGEKEVRSVFPEAIIIRPSDIFGREDRFLNHFANYRWFLAVPLVSLGFKTVKQPVYVADVSKGIVNATKDPDAVGKTFAFTGPNRYLLFHLVKYIFGMTHRTFIPYPLPLFVYSWIGKLFGLSPFEPWTTKDKVERIHISDVMPTDLPGLEDLGVQPTPLELKSIEVLRRHRTYRWLSSEIEETKPAKTVNY

Entity 31 Entity 31 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Molecular weight formula_weight	19814.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q1

MAAVSISVSLRQAMLGRRAMATAAVSVCRVPSRLLSTSTWKLADNQTRDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEKKVPKPKSKSYGANFSWNKRTRVSTK

Entity 32 Entity 32 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
Molecular weight formula_weight	13041.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

MAAVLTFRRLLTLPRAARGFGVQVSPSGEKITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIAQQPVNEVEHRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFKQHHH

Entity 33 Entity 33 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
Molecular weight formula_weight	10932.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S1

MAAAAASRAVGAKLGLREIRVHLCQRSPGSQGVRDFIVQRYVELKKAHPNLPILIRECSEVQPKLWARYAFGQEKTVSLNNLSADEVTRAMQNVLSGKA

Entity 34 Entity 34 polymer

Description description	Acyl carrier protein, mitochondrial
Molecular weight formula_weight	17390.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T1,U1

MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 35 Entity 35 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
Molecular weight formula_weight	13380.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V1

MAGLLKKTTGLVGLAVCDTPHERLTILYTKTLDILKHFPKHAAYRKYTEQITNEKLDMVKAEPDVKKLEALLQGGEVEEVILQAEKELSLARKMLKWKPWEPLVEEPPANQWKWPI

Entity 36 Entity 36 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
Molecular weight formula_weight	15311.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W1

MAAAATGLRQAAAAAASTSVKPIFSRDLNEAKRRVRELYRAWYREVPNTVHLMQLDITVKQGRDKVREMFMKNAHVTDPRVVDLLVIKGKMELQETIKVWKQRTHVMRFFHETETPRPKDFLSKFYMGHDP

Entity 37 Entity 37 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Molecular weight formula_weight	17112.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q1

MELVEVLKRGVQQVTGHGGLRGLLRVFFRANDIRIGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTTNPPTARKFIWTNHKFNVSATPEQYVPYSTTRKKIHEWVPPSTPYK

Entity 38 Entity 38 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
Molecular weight formula_weight	12637.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r1

MASATRVIQKLRNWASGQDLQAKLQLRYQEIAKRTQPPPKLPVGPSHKLSNNYYCTRDGRREVVPPSIIMSSQKALVSGKAAESSAMAATEKKAVTPAPPMKRWELSKDQPYL

Entity 39 Entity 39 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
Molecular weight formula_weight	11833.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s1

MAVSLLLRGGRIRALKAVLLEARVFPGELVSVVRLSTESEKSAKEKELHPKTQSVLKEPEPTDTTTYKNLQHHDYNTYTFLDLNLDLSKFRLPQPSSGRESPRH

Entity 40 Entity 40 polymer

Description description	NADH-ubiquinone oxidoreductase chain 3
Molecular weight formula_weight	13251.8 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1

MNLYTVIFINILLSLTLILVAFWLPQMNLYSEKANPYECGFDPTSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQTIKTSTMMIMAFILVTILSLGLAYEWTQKGLEWTE

Entity 41 Entity 41 polymer

Description description	NADH-ubiquinone oxidoreductase chain 1
Molecular weight formula_weight	36105.0 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H1

MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNLGILFILATSSLSVYSILWSGWASNSKYSLFGALRAVAQTISYEVTMAIILLSVLLMNGSYSLQTLITTQEHMWLLLPAWPMAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALTTIIFLGPLYYINLPELYSTNFMMEALLLSSTFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHISLPIFTAGVPPYM

Entity 42 Entity 42 polymer

Description description	NADH-ubiquinone oxidoreductase chain 6
Molecular weight formula_weight	18656.1 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J1

MNNYIFVLSSLFLVGCLGLALKPSPIYGGLGLIVSGFVGCLMVLGFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEEYPETWGSNWLILGFLVLGVIMEVFLICVLNYYDEVGVINLDGLGDWLMYEVDDVGVMLEGGIGVAAMYSCATWMMVVAGWSLFAGIFIIIEITRD

Entity 43 Entity 43 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4L
Molecular weight formula_weight	10637.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K1

MPSTFFNLTMAFSLSLLGTLMFRSHLMSTLLCLEGMVLSLFIMTSVTSLNSNSMSSMPIPITILVFAACEAAVGLALLVKVSNTYGTDYVQNLNLLQC

Entity 44 Entity 44 polymer

Description description	NADH-ubiquinone oxidoreductase chain 5
Molecular weight formula_weight	68547.3 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L1

MNIFTTSILLIFILLLSPILISMSNLIKHINFPLYTTTSIKFSFIISLLPLLMFFHNNMEYMITTWHWVTMNSMELKMSFKTDFFSILFTSVALFVTWSIMQFSSWYMHSDPNINRFIKYLTLFLITMLILTSANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMVWFSLNMNSWELQQIMFSNNNDNLIPLMGLLIAATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLVRFHPLTTNNNFILTTMLCLGALTTLFTAICALTQNDIKKIIAFSTSSQLGLMMVTLGMNQPHLAFLHICTHAFFKAMLFMCSGSIIHSLADEQDIRKMGNITKIMPFTSSCLVIGSLALTGMPFLTGFYSKDLIIEAINTCNTNAWALLITLIATSMTAMYSMRIIYFVTMTKPRFPPLISINENDPDLMNPIKRLAFGSIFAGFVISYNIPPTSIPVLTMPWFLKTTALIISVLGFLIALELNNLTMKLSMNKANPYSSFSTLLGFFPSIIHRITPMKSLNLSLKTSLTLLDLIWLEKTIPKSTSTLHTNMTTLTTNQKGLIKLYFMSFLINIILIIILYSINLE

Entity 45 Entity 45 polymer

Description description	NADH-ubiquinone oxidoreductase chain 4
Molecular weight formula_weight	51943.5 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M1

MLKIILPSLMLLPLTWLSSPKKTWTNVTSYSFLISLTSLTLLWQTDENYKNFSNMFSSDPLSTPLIILTAWLLPLMLMASQNHLKKDNNVLQKLYISMLISLQILLIMTFSATELIMFYILFEATLIPTLIIITRWGNQTERLNAGIYFLFYTLIGSIPLLIALILIQNHVGTLNLMILSFTTHTLDASWSNNLLWLACMMAFLIKMPLYGVHLWLPKAHVEAPIAGSMILAAILLKLGSYGMIRISIILDPLTKYMAYPFILLSLWGMIMTSSICLRQTDLKSLIAYSSVSHMALVIASIMIQTPWSFMGATMLMIAHGLTSSLLFCLANSNYERIHSRTMIMARGLQMVFPLMATWWLMASLANLALPPSINLMGELFITMSLFSWSNFTIILMGINIIITGMYSMYMIITTQRGKLTNHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLTM

Entity 46 Entity 46 polymer

Description description	NADH-ubiquinone oxidoreductase chain 2
Molecular weight formula_weight	38800.2 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N1

MNPITLAIIYFTIFLGPVITMSSTNLMLMWVGLEFSLLAIIPMLINKKNPRSTEAATKYFVTQATASMIILLAIVLNYKQLGTWMFQQQTNGLILNMTLMALSMKLGLAPFHFWLPEVTQGIPLHMGLILLTWQKIAPLSILIQIYPLLNSTIILMLAITSIFMGAWGGLNQTQMRKIMAYSSIAHMGWMLAILPYNPSLTLLNLMIYIILTAPMFMALMLNNSMTINSISLLWNKTPAMLTMISLMLLSLGGLPPLTGFLPKWIIITELMKNNCLIMATLMAMMALLNLFFYTRLIYSTSLTMFPTNNNSKMMTHQTKTKPNLMFSTLAIMSTMTLPLAPQLIT

Entity 47 Entity 47 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
Molecular weight formula_weight	40657.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O1

MALRLLRLVPASAPARGLAAGAQRVGRIHTSVHCKLRYGLLAAILGDKTTKKLHEYSRVITVDGNICSGKNKLAKEIAQQLGMKHYPEAGIQYSSTTTGDGRPLDIEFSGSCSLEKFYDDPKSNDGNSYRLQSWLYASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYNQGYIRKQCVDHYNEIKRLTLPEYLPPHAVIYIDVPVPEVQSRIQKKGDPHEMKVTSAYLQDIENAYKKTFLPKMSEMCEVLVYDSWEAEDPTKVVEDIEYLKYNKGPWLKQDDWTFHYLRMLVQDKTEVLNYTTIPVYLPEITIGAHQGSRIYNSFRELPGRKYAPGYNAEVGDKWIWLK

Entity 48 Entity 48 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Molecular weight formula_weight	20025.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X1

MPGIVELPTLEELKVEEVKVSSAVLKAAAHHYGAQCDKTNKEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLDYSNMQLFRHCRQQQAKFDQCVLDKLGWVRPDLGQLSKVTKVKTDRPLPENPYHSRARPEPNPVIEGDLKPAKHGTRFFFWTV

Entity 49 Entity 49 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
Molecular weight formula_weight	14928.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y1

MVKRFFESYHEVPDGTQCHRKTYITTALGGICGIIGSAYSVSLNPADSTLEAVARVGRYTFTAAAIGAMFGLTTCVSAQVREKPDDPLNYFIGGCAGGLTLGARTHSYGTAAMGCVYMGTAAALFKIGKLEGWELFPTPKV

Entity 50 Entity 50 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Molecular weight formula_weight	16881.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z1

MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGALIFGYWRMMRWNQERRRLLIEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESVFHTTRWVPPLIGEMYGLRTKEEMSNANFGFTWYT

Entity 51 Entity 51 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Molecular weight formula_weight	8149.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a1

MWFEILPGLAIMGVCLVIPGVSTAYIHKFTNGGKEKRVARVQYQWYLMERDRRISGVNRYYVSKGLENID

Entity 52 Entity 52 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
Molecular weight formula_weight	9380.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b1

MAGRISAFLKNAWAKEPVLVVSFSVWGLAIIMPMISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL

Entity 53 Entity 53 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial
Molecular weight formula_weight	8636.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c1

MAPSVVLRSFSRLLAPARLPSCSSTRSKFYVREPVNAKPNWLAVGLSVGASVFMWIYLIQTHNEDVLEYKRRNGLE

Entity 54 Entity 54 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 subunit C2
Molecular weight formula_weight	14185.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d1

MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHRQLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR

Entity 55 Entity 55 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
Molecular weight formula_weight	12675.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e1

MPFLDIQKKLGISLDRHFMFLSAEQPYKNAARCHAFEKEWIECAHGIGGTRAKKECKIEFDDFEECLLRYKTMRRMHDIKKQREKLMKEGKYTPPPHHSGREEPRP

Entity 56 Entity 56 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
Molecular weight formula_weight	6965.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f1

MTLFQLLREHWVHILVPAGFVFGCYLDRKDDEKLTAFRNKSMLFQRELRPNEEVTWK

Entity 57 Entity 57 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
Molecular weight formula_weight	17463.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g1

MAARLLSLYGRCLSAAGAMRGLPAARVRWESSRAVIAPSGVEKKRQREPTMQWQEDPEPEDENVYAKNPDFHGYDSDPVVDVWNMRAVFFFGFSIVLVFGTTFVAYVPDYRMQEWARREAERLVKYREVNGLPIMESNYFDPSKIQLPEDD

Entity 58 Entity 58 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
Molecular weight formula_weight	21742.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h1

MAAMSLLQRASVSALTALSCRRAGPRLGVGSFLTRSFPKTVAPVRHSGDHGKRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRWIARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQFPTPEKEFIDHSPKATPDN

Entity 59 Entity 59 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
Molecular weight formula_weight	15582.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i1

MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNMVFKAYRSSLFAVSHVLIPMWFVHYYVKYHMATKPYTIVSSKPRIFPGDTILETGEVIPPMRDFPDQHH

Entity 60 Entity 60 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial
Molecular weight formula_weight	11982.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j1

MSALTRLVPFGRVGGRLLRGCRARAAGDSGVRHAGGGVHIQPRYREFPQLTRSQVIQGEFLSSLMWFWILWRFWHDSDAVLGHFSYPDPSQWTDEELGIPPDDED

Entity 61 Entity 61 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
Molecular weight formula_weight	11714.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k1

MAAGHGHEHGHEHGHGHGKMELPDYRQWKIEGTPLETVQKKLAARGLRDPWARNEAWRYMGGFAGNITFPSVILKGFKWGFAAFVVALGAEYFLDSQNGDKKHH

Entity 62 Entity 62 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
Molecular weight formula_weight	21903.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l1

MAAARAAALGVRWLQRTTRGVVPLEARRAFHMTKDMLPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLPNRSQHERDPWYQWDHSELRMNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCKHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEPVVHYDI

Entity 63 Entity 63 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
Molecular weight formula_weight	15105.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m1

MSGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHIEDPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGKLDRKFNISY

Entity 64 Entity 64 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
Molecular weight formula_weight	22020.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n1

MAFCAPPAYLTHQQKVLRLYKRALRHLESWCIHRDKYRYFACLMRARFEEHKNEKDMMRATQLLREAEEEFWQNQHPQPYIFPDSPGGTSFERYECYKVPEWCLDYWHPSEKAMYPDYFSKREQWKKLRMESWDREVKQLQEETSPDGIMTEALPPARREGDLPPLWWHIVTRPRERPT

Entity 65 Entity 65 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
Molecular weight formula_weight	16360.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o1

MGAHLTRRYLWDASVEPDPEKIPSFPPDLGFPERKERVMVATQQEMMDAQLTLQQRDYCAHYLIRLLKCKRDSFPNFLACKHEQHDWDYCEHLDYVKRMKEFERERRLLQRKKRRALKEARVAQGQGEGEVGPEVAL

Entity 66 Entity 66 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
Molecular weight formula_weight	21054.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p1

MPDSWDKDVYPEPPSRTPAPSPQTSLPNPITYLTKAYDLVVDWPVTLVREFIERQHAKNRTYYYHRQYRRVPDITECKEGDVLCIYEAEMQWRRDFKVDQEIMNIIQERLKACQQREGENYQQNCAKELEQFTKVTKAYQDRYLDLGAYYSARKCLAKQKQRMLEERKAARQEAAA

Entity 67 Entity 67 polymer

Description description	Cytochrome c oxidase subunit 8A, mitochondrial
Molecular weight formula_weight	7659.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MSVLTPLLLRSLTGSARRLMVPRAQVHSKPAREQLGVLDITIGLTSCFVCCLLPAGWVLSHLESYKKRE

Entity 68 Entity 68 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 69 Entity 69 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 70 Entity 70 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 71 Entity 71 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	33

Entity 72 Entity 72 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 73 Entity 73 non-polymer

Description description	DINUCLEAR COPPER ION
Molecular weight formula_weight	127.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 74 Entity 74 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 75 Entity 75 non-polymer

Description description	TRISTEAROYLGLYCEROL
Molecular weight formula_weight	891.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 76 Entity 76 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 77 Entity 77 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 78 Entity 78 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 79 Entity 79 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 80 Entity 80 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 81 Entity 81 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 82 Entity 82 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 83 Entity 83 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 84 Entity 84 non-polymer

Description description	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	745.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 85 Entity 85 non-polymer

Description description	S-[2-({N-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}amino)ethyl] tetradecanethioate
Molecular weight formula_weight	568.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 86 Entity 86 non-polymer

Description description	2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	57506

A respirasome from murine liver

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 5A, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 5B, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6A1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6B1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 7B, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer