8ib7

Respiratory complex CIII2, focus-refined of type IA, Wild type mouse under cold temperature

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 UBIQUINONE-10 × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CARDIOLIPIN × 4 HEME C × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AA； PDBConstruct 1–480； UniProt 1–480 Author chain Aa； PDBConstruct 1–480； UniProt 1–480

Cytochrome b-c1 complex subunit 2, mitochondrial

OrganismNot specified

UniProt Q9DB77

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 UBIQUINONE-10 × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CARDIOLIPIN × 4 HEME C × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR2_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AB； PDBConstruct 1–453； UniProt 1–453 Author chain Ab； PDBConstruct 1–453； UniProt 1–453

Cytochrome b

OrganismNot specified

UniProt P00158

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 UBIQUINONE-10 × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CARDIOLIPIN × 4 HEME C × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AC； PDBConstruct 1–381； UniProt 1–381 Author chain Ac； PDBConstruct 1–381； UniProt 1–381

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt Q9D0M3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 UBIQUINONE-10 × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CARDIOLIPIN × 4 HEME C × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AD； PDBConstruct 1–325； UniProt 1–325 Author chain Ad； PDBConstruct 1–325； UniProt 1–325

Cytochrome b-c1 complex subunit Rieske, mitochondrial

OrganismNot specified

UniProt Q9CR68

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 UBIQUINONE-10 × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CARDIOLIPIN × 4 HEME C × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AE； PDBConstruct 1–274； UniProt 1–274 Author chain AI； PDBConstruct 1–274； UniProt 1–274 Author chain Ae； PDBConstruct 1–274； UniProt 1–274

Cytochrome b-c1 complex subunit 7

OrganismNot specified

UniProt Q9CQB4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 UBIQUINONE-10 × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CARDIOLIPIN × 4 HEME C × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9CQB4_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AF； PDBConstruct 1–111； UniProt 1–111 Author chain Af； PDBConstruct 1–111； UniProt 1–111

Cytochrome b-c1 complex subunit 8

OrganismNot specified

UniProt Q9CQ69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 UBIQUINONE-10 × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CARDIOLIPIN × 4 HEME C × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR8_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AG； PDBConstruct 1–82； UniProt 1–82 Author chain Ag； PDBConstruct 1–82； UniProt 1–82

Cytochrome b-c1 complex subunit 6, mitochondrial

OrganismNot specified

UniProt P99028

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 UBIQUINONE-10 × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CARDIOLIPIN × 4 HEME C × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR6_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AH； PDBConstruct 1–89； UniProt 1–89 Author chain Ah； PDBConstruct 1–89； UniProt 1–89

Cytochrome b-c1 complex subunit 9

OrganismNot specified

UniProt Q8R1I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 10 × 2 （Q9CPX8） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 UBIQUINONE-10 × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CARDIOLIPIN × 4 HEME C × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR9_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain AJ； PDBConstruct 1–64； UniProt 1–64 Author chain Aj； PDBConstruct 1–64； UniProt 1–64

Cytochrome b-c1 complex subunit 10

OrganismNot specified

UniProt Q9CPX8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 21	Cytochrome b-c1 complex subunit 1, mitochondrial × 2 （Q9CZ13） Cytochrome b-c1 complex subunit 2, mitochondrial × 2 （Q9DB77） Cytochrome b × 2 （P00158） Cytochrome c1, heme protein, mitochondrial × 2 （Q9D0M3） Cytochrome b-c1 complex subunit Rieske, mitochondrial × 3 （Q9CR68） Cytochrome b-c1 complex subunit 7 × 2 （Q9CQB4） Cytochrome b-c1 complex subunit 8 × 2 （Q9CQ69） Cytochrome b-c1 complex subunit 6, mitochondrial × 2 （P99028） Cytochrome b-c1 complex subunit 9 × 2 （Q8R1I1） PROTOPORPHYRIN IX CONTAINING FE × 4 1,2-Distearoyl-sn-glycerophosphoethanolamine × 5 UBIQUINONE-10 × 2 5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL × 2 CARDIOLIPIN × 4 HEME C × 2 1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCR10_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain AK； PDBConstruct 1–56； UniProt 1–56 Author chain Ak； PDBConstruct 1–56； UniProt 1–56

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ib7
Deposition date deposition_date	2023-02-09
Structure title title	Respiratory complex CIII2, focus-refined of type IA, Wild type mouse under cold temperature
Keywords keywords	Respiratory complex, Respiratory supercomplex, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ib7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ib7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ib7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	54.50 Å
Rg (electron density)	53.57 Å
Total Rg	53.74 Å
Atom count	31874
Residues	3938
Excluded volume	570940 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ib7__assembly_1__model_1`	21-meric （21）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Cytochrome b-c1 complex subunit 1, mitochondrial
Molecular weight formula_weight	52910.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,Aa
Atom count atom_count	31874

MAASAVCRAACSGTQVLLRTRRSPALLRLPALRGTATFAQALQSVPETQVSILDNGLRVASEQSSHATCTVGVWIDAGSRYETEKNNGAGYFLEHLAFKGTKNRPGNALEKEVESIGAHLNAYSTREHTAYLIKALSKDLPKVVELLADIVQNSSLEDSQIEKERDVILREMQENDASMQNVVFDYLHATAFQGTPLAQAVEGPSENVRRLSRTDLTDYLNRHYKAPRMVLAAAGGVEHQQLLDLAQKHLSSVSRVYEEDAVPGLTPCRFTGSEIRHRDDALPLAHVAIAVEGPGWANPDNVTLQVANAIIGHYDCTYGGGVHLSSPLASVAVANKLCQSFQTFNISYSDTGLLGAHFVCDAMSIDDMVFFLQGQWMRLCTSATESEVTRGKNILRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIQEVDAQMLRDICSKYFYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF

Entity 2 Entity 2 polymer

Description description	Cytochrome b-c1 complex subunit 2, mitochondrial
Molecular weight formula_weight	48289.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB,Ab

MKLLSRAGSFSRFYSLKVAPKVKTSAAPGGVPLQPQDLEFTKLPNGLVIASLENYAPLSRIGLFVKAGSRYEDSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVEGIRSDIEILMEFLLNVTTAPEFRRWEVAALRSQLKIDKAVAFQNSQTRIIENLHDVAYKNALANPLYCPDYRMGKITSEELHYFVQNHFTSARMALVGLGVSHSVLKQVAEQFLNMRGGLGLAGAKAKYRGGEIREQNGDNLVHAAIVAESAAIGNAEANAFSVLQHLLGAGPHIKRGNNTTSLLSQSVAKGSHQPFDVSAFNASYSDSGLFGIYTISQAAAAGEVINAAYNQVKAVAQGNLSSADVQAAKNKLKAGYLMSVETSEGFLSEIGSQALAAGSYMPPSTVLQQIDSVADADVVKAAKKFVSGKKSMAASGNLGHTPFLDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	43240.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC,Ac

MTNMRKTHPLFKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQIITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGLYYGSYTFMETWNIGVLLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHPYYTIKDILGILIMFLILMTLVLFFPDMLGDPDNYMPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALILSILILALMPFLHTSKQRSLMFRPITQILYWILVANLLILTWIGGQPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKLYP

Entity 4 Entity 4 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	35374.7 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AD,Ad

MAAAAASLRRTVLGPRGVGLPGASAPGLLGGARSRQLPLRTPQAVSLSSKSGPSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNDDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEYDDGTPATMSQVAKDVATFLRWASEPEHDHRKRMGLKMLLMMGLLLPLTYAMKRHKWSVLKSRKLAYRPPK

Entity 5 Entity 5 polymer

Description description	Cytochrome b-c1 complex subunit Rieske, mitochondrial
Molecular weight formula_weight	29406.6 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AE,AI,Ae

MLSVAARSGPFAPVLSATSRGVAGALRPLLQGAVPAASEPPVLDVKRPFLCRESLSGQAAARPLVATVGLNVPASVRFSHTDVKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPAYEFTSDDVVVVG

Entity 6 Entity 6 polymer

Description description	Cytochrome b-c1 complex subunit 7
Molecular weight formula_weight	13587.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AF,Af

MAGRSAVSASSKWLDGFRKWYYNAAGFNKLGLMRDDTLHETEDVKEAIRRLPEDLYNDRMFRIKRALDLTMRHQILPKDQWTKYEEDKFYLEPYLKEVIRERKEREEWAKK

Entity 7 Entity 7 polymer

Description description	Cytochrome b-c1 complex subunit 8
Molecular weight formula_weight	9783.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AG,Ag

MGREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIYTWGNQEFEQSKRKNPAMYENDK

Entity 8 Entity 8 polymer

Description description	Cytochrome b-c1 complex subunit 6, mitochondrial
Molecular weight formula_weight	10452.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AH,Ah

MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLELCDNRVSSRSQTEEDCTEELFDFLHARDHCVAHKLFKNLK

Entity 9 Entity 9 polymer

Description description	Cytochrome b-c1 complex subunit 9
Molecular weight formula_weight	7457.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AJ,Aj

MSSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE

Entity 10 Entity 10 polymer

Description description	Cytochrome b-c1 complex subunit 10
Molecular weight formula_weight	6546.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AK,Ak

MLSRFLGPRYRELARNWIPTAGMWGTVGAVGLVWATDWRLILDWVPYINGKFKKDD

Entity 11 Entity 11 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 12 Entity 12 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 13 Entity 13 non-polymer

Description description	UBIQUINONE-10
Molecular weight formula_weight	863.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	5-(3,7,11,15,19,23-HEXAMETHYL-TETRACOSA-2,6,10,14,18,22-HEXAENYL)-2,3-DIMETHOXY-6-METHYL-BENZENE-1,4-DIOL
Molecular weight formula_weight	592.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 16 Entity 16 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 17 Entity 17 non-polymer

Description description	1,2-DIACYL-GLYCEROL-3-SN-PHOSPHATE
Molecular weight formula_weight	705.0 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	151188

Respiratory complex CIII2, focus-refined of type IA, Wild type mouse under cold temperature

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b-c1 complex subunit 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit Rieske, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 6, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b-c1 complex subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer