7p5w

Structure of homomeric LRRC8A Volume-Regulated Anion Channel in complex with synthetic nanobody Sb2

Method: ELECTRON MICROSCOPY D_max: 199.9 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Volume-regulated anion channel subunit LRRC8A

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 15–808 Chain B； UniProt 15–808 Chain C； UniProt 15–808 Chain D； UniProt 15–808 Chain E； UniProt 15–808 Chain F； UniProt 15–808	Not recorded	synthetic nanobody Sb2 × 6	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE-PROPANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7P5W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6FNW Structure of a volume-regulated anion channel of the LRRC8 family Deposited 2018-02-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 398–810（413 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277.15 K；22% PEG 3350, 0.2M Na/K tartrate, 0.1M Bis-Tris propane pH 8.5	Resolution 1.80 Å R-free 0.208
6G8Z Structure of the pore domain of homomeric mLRRC8A volume-regulated anion channel at 3.66 A resolution Deposited 2018-04-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–810（810 aa） Chain B 1–810（810 aa） Chain C 1–810（810 aa） Chain D 1–810（810 aa） Chain E 1–810（810 aa） Chain F 1–810（810 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.66 Å
6G9L Structure of homomeric mLRRC8A volume-regulated anion channel at 5.01 A resolution Deposited 2018-04-11	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–810（810 aa） Chain B 1–810（810 aa） Chain C 1–810（810 aa） Chain D 1–810（810 aa） Chain E 1–810（810 aa） Chain F 1–810（810 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.01 Å
6G9O Structure of full-length homomeric mLRRC8A volume-regulated anion channel at 4.25 A resolution Deposited 2018-04-11	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–810（810 aa） Chain B 1–810（810 aa） Chain C 1–810（810 aa） Chain D 1–810（810 aa） Chain E 1–810（810 aa） Chain F 1–810（810 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.25 Å
6NZW LRRC8A-DCPIB in MSP1E3D1 nanodisc constricted state Deposited 2019-02-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–810（810 aa） Chain B 1–810（810 aa） Chain C 1–810（810 aa） Chain D 1–810（810 aa） Chain E 1–810（810 aa） Chain F 1–810（810 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 18 L9Y 4-{[(2S)-2-butyl-6,7-dichloro-2-cyclopentyl-1-oxo-2,3-dihydro-1H-inden-5-yl]oxy}butanoic acid × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter drop size, 3 second blot time	Resolution 3.21 Å
6NZZ LRRC8A-DCPIB in MSP1E3D1 nanodisc expanded state Deposited 2019-02-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–810（810 aa） Chain B 1–810（810 aa） Chain C 1–810（810 aa） Chain D 1–810（810 aa） Chain E 1–810（810 aa） Chain F 1–810（810 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 18 L9Y 4-{[(2S)-2-butyl-6,7-dichloro-2-cyclopentyl-1-oxo-2,3-dihydro-1H-inden-5-yl]oxy}butanoic acid × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter drop size, 3 second blot time	Resolution 3.32 Å
6O00 apo-LRRC8A in MSP2N2 nanodisc constricted state Deposited 2019-02-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–810（810 aa） Chain B 1–810（810 aa） Chain C 1–810（810 aa） Chain D 1–810（810 aa） Chain E 1–810（810 aa） Chain F 1–810（810 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；3 microliter drop size, 3 second blot time	Resolution 4.18 Å
7M17 SN-407-LRRC8A in MSP1E3D1 lipid nanodiscs (Pose-1) Deposited 2021-03-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–810（810 aa） Chain B 1–810（810 aa） Chain C 1–810（810 aa） Chain D 1–810（810 aa） Chain E 1–810（810 aa） Chain F 1–810（810 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 18 YNJ 7-{[(2S)-2-butyl-6,7-dichloro-2-cyclopentyl-1-oxo-2,3-dihydro-1H-inden-5-yl]oxy}heptanoic acid × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；pH to 7.4 with KOH cryo-EM vitrification conditions Cryogen ETHANE；2 microliter drop size, manual wait time of 2 seconds, blot force of 1, 3 second blot time	Resolution 3.65 Å
7M19 SN-407-LRRC8A in MSP1E3D1 lipid nanodiscs (Pose-2) Deposited 2021-03-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–810（810 aa） Chain B 1–810（810 aa） Chain C 1–810（810 aa） Chain D 1–810（810 aa） Chain E 1–810（810 aa） Chain F 1–810（810 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 18 YNJ 7-{[(2S)-2-butyl-6,7-dichloro-2-cyclopentyl-1-oxo-2,3-dihydro-1H-inden-5-yl]oxy}heptanoic acid × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；pH to 7.4 with KOH cryo-EM vitrification conditions Cryogen ETHANE；2 microliter drop size, manual wait time of 2 seconds, blot force of 1, 3 second blot time	Resolution 3.69 Å
7P5V Structure of homomeric LRRC8A Volume-Regulated Anion Channel in complex with synthetic nanobody Sb1 Deposited 2021-07-15	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 15–808（794 aa） Chain B 15–808（794 aa） Chain C 15–808（794 aa） Chain D 15–808（794 aa） Chain E 15–808（794 aa） Chain F 15–808（794 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.06 Å
7P5Y Structure of homomeric LRRC8A Volume-Regulated Anion Channel in complex with synthetic nanobody Sb3 Deposited 2021-07-15	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 15–808（794 aa） Chain B 15–808（794 aa） Chain C 15–808（794 aa） Chain D 15–808（794 aa） Chain E 15–808（794 aa） Chain F 15–808（794 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.29 Å
7P60 Structure of homomeric LRRC8A Volume-Regulated Anion Channel in complex with synthetic nanobody Sb4 at 1:0.5 ratio Deposited 2021-07-15	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–810（810 aa） Chain B 1–810（810 aa） Chain C 1–810（810 aa） Chain D 1–810（810 aa） Chain E 1–810（810 aa） Chain F 1–810（810 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
7P6K Structure of homomeric LRRC8A Volume-Regulated Anion Channel in complex with synthetic nanobody Sb5 Deposited 2021-07-16	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–810（810 aa） Chain B 1–810（810 aa） Chain C 1–810（810 aa） Chain D 1–810（810 aa） Chain E 1–810（810 aa） Chain F 1–810（810 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
8B41 Structure of heteromeric LRRC8A/C (1:1 co-transfected) Volume-Regulated Anion Channel in complex with synthetic nanobody Sb1 Deposited 2022-09-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 2–810（809 aa） Chain B 2–810（809 aa） Chain C 2–810（809 aa） Chain D 2–810（809 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.80 Å
8B42 Structure of heteromeric LRRC8A/C Volume-Regulated Anion Channel. Deposited 2022-09-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 2–810（809 aa） Chain B 2–810（809 aa） Chain C 2–810（809 aa） Chain D 2–810（809 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8.5 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.60 Å
8DR8 LRRC8A:C conformation 2 (oblong) top mask Deposited 2022-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–71（71 aa） Chain A 91–810（720 aa） Chain B 1–71（71 aa） Chain B 91–810（720 aa） Chain C 1–71（71 aa） Chain C 91–810（720 aa） Chain D 1–71（71 aa） Chain D 91–810（720 aa） Chain E 1–71（71 aa） Chain E 91–810（720 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
8DRA LRRC8A:C conformation 2 (oblong) LRR mask Deposited 2022-07-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–71（71 aa） Chain A 91–810（720 aa） Chain B 1–71（71 aa） Chain B 91–810（720 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.98 Å
8DRE LRRC8A:C conformation 2 (oblong) Deposited 2022-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–71（71 aa） Chain A 91–810（720 aa） Chain B 1–71（71 aa） Chain B 91–810（720 aa） Chain C 1–71（71 aa） Chain C 91–810（720 aa） Chain D 1–71（71 aa） Chain D 91–810（720 aa） Chain E 1–71（71 aa） Chain E 91–810（720 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.18 Å
8DRK LRRC8A:C conformation 1 (round) top focus Deposited 2022-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–71（71 aa） Chain A 91–810（720 aa） Chain B 1–71（71 aa） Chain B 91–810（720 aa） Chain C 1–71（71 aa） Chain C 91–810（720 aa） Chain D 1–71（71 aa） Chain D 91–810（720 aa） Chain E 1–71（71 aa） Chain E 91–810（720 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
8DRN LRRC8A:C conformation 1 (round) LRR focus 1 Deposited 2022-07-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–71（71 aa） Chain A 91–810（720 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.12 Å
8DRO LRRC8A:C conformation 1 (round) LRR focus 2 Deposited 2022-07-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 1–71（71 aa） Chain B 91–810（720 aa） Chain C 1–71（71 aa） Chain C 91–810（720 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.06 Å
8DRQ LRRC8A:C conformation 1 (round) LRR focus 3 Deposited 2022-07-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain E 1–71（71 aa） Chain E 91–810（720 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å
8DS3 LRRC8A:C conformation 1 (round) Deposited 2022-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–71（71 aa） Chain A 91–810（720 aa） Chain B 1–71（71 aa） Chain B 91–810（720 aa） Chain C 1–71（71 aa） Chain C 91–810（720 aa） Chain D 1–71（71 aa） Chain D 91–810（720 aa） Chain E 1–71（71 aa） Chain E 91–810（720 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.07 Å
8DS9 LRRC8A:C in MSPE3D1 nanodisc top focus Deposited 2022-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–71（71 aa） Chain A 91–810（720 aa） Chain B 1–71（71 aa） Chain B 91–810（720 aa） Chain C 1–71（71 aa） Chain C 91–810（720 aa） Chain D 1–71（71 aa） Chain D 91–810（720 aa） Chain E 1–71（71 aa） Chain E 91–810（720 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
8DSA LRRC8A:C in MSP1E3D1 nanodisc Deposited 2022-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–71（71 aa） Chain A 91–810（720 aa） Chain B 1–71（71 aa） Chain B 91–810（720 aa） Chain C 1–71（71 aa） Chain C 91–810（720 aa） Chain D 1–71（71 aa） Chain D 91–810（720 aa） Chain E 1–71（71 aa） Chain E 91–810（720 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.48 Å
8F74 LRRC8A(T48D):C conformation 2 top focus Deposited 2022-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–76（76 aa） Chain A 92–810（719 aa） Chain B 1–76（76 aa） Chain B 92–810（719 aa） Chain C 1–76（76 aa） Chain C 92–810（719 aa） Chain D 1–76（76 aa） Chain D 92–810（719 aa） Chain E 1–76（76 aa） Chain E 92–810（719 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8F75 LRRC8A(T48D):C conformation 2 LRR focus Deposited 2022-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 91–810（720 aa） Chain B 91–810（720 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.00 Å
8F77 LRRC8A(T48D):C conformation 2 top focus Deposited 2022-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–76（76 aa） Chain A 90–810（721 aa） Chain B 1–76（76 aa） Chain B 90–810（721 aa） Chain C 1–76（76 aa） Chain C 90–810（721 aa） Chain D 1–76（76 aa） Chain D 90–810（721 aa） Chain E 1–76（76 aa） Chain E 90–810（721 aa）	Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
8F79 LRRC8A(T48D):C conformation 2 top focus Deposited 2022-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–76（76 aa） Chain A 90–810（721 aa） Chain B 1–76（76 aa） Chain B 90–810（721 aa） Chain C 1–76（76 aa） Chain C 90–810（721 aa） Chain D 1–76（76 aa） Chain D 90–810（721 aa） Chain E 1–76（76 aa） Chain E 90–810（721 aa）	Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
8F7B LRRC8A(T48D):C conformation 2 top focus Deposited 2022-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–76（76 aa） Chain A 90–810（721 aa） Chain B 1–76（76 aa） Chain B 90–810（721 aa） Chain C 1–76（76 aa） Chain C 90–810（721 aa） Chain D 1–76（76 aa） Chain D 90–810（721 aa） Chain E 1–76（76 aa） Chain E 90–810（721 aa）	Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 17	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.15 Å
8F7D LRRC8A(T48D):C conformation 2 top focus Deposited 2022-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–76（76 aa） Chain A 90–810（721 aa）	Mutation：T48D Mutation：T48D	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8F7E LRRC8A(T48D):C conformation 2 top focus Deposited 2022-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 1–76（76 aa） Chain B 90–810（721 aa） Chain C 1–76（76 aa） Chain C 90–810（721 aa）	Mutation：T48D Mutation：T48D Mutation：T48D Mutation：T48D	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.13 Å
8F7J LRRC8A(T48D):C conformation 2 top focus Deposited 2022-11-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain E 1–76（76 aa） Chain E 90–810（721 aa）	Mutation：T48D Mutation：T48D	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.32 Å
9DX7 LRRC8A:D Conformation 1 Deposited 2024-10-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–76（76 aa） Chain A 91–810（720 aa） Chain B 1–76（76 aa） Chain B 91–810（720 aa） Chain C 1–76（76 aa） Chain C 91–810（720 aa） Chain D 1–76（76 aa） Chain D 91–810（720 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9DXA LRRC8A:D Conformation 2 Deposited 2024-10-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–76（76 aa） Chain A 91–810（720 aa） Chain B 1–76（76 aa） Chain B 91–810（720 aa） Chain C 1–76（76 aa） Chain C 91–810（720 aa） Chain D 1–76（76 aa） Chain D 91–810（720 aa）	Not recorded	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å

35 other PDB entries and 35 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LRC8A_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 15–808； UniProt 15–808 Author chain B； PDBConstruct 15–808； UniProt 15–808 Author chain C； PDBConstruct 15–808； UniProt 15–808 Author chain D； PDBConstruct 15–808； UniProt 15–808 Author chain E； PDBConstruct 15–808； UniProt 15–808 Author chain F； PDBConstruct 15–808； UniProt 15–808

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7p5w
Deposition date deposition_date	2021-07-15
Structure title title	Structure of homomeric LRRC8A Volume-Regulated Anion Channel in complex with synthetic nanobody Sb2
Keywords keywords	LRRC8 family, Volume-Regulated Anion Channel, leucine-rich repeat, sybody, cryo-EM, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	63.48 Å
Radius of gyration Rg (electron density) rg_electron	62.60 Å
Forward intensity I(0) i0	4311530000.00
Molecular weight molecular_weight	584520.0 kDa
Excluded volume excluded_volume	744060 Å³
Envelope volume envelope_volume	1128000 Å³
Hydration-shell volume shell_volume	149600 Å³
Envelope diameter envelope_diameter	190.0 Å
Shell Rg shell_rg	66.07 Å
Envelope Rg envelope_rg	59.55 Å
Shape Rg shape_rg	62.56 Å
Total Rg total_rg	62.79 Å
Total atoms total_atoms	41250
Residues n_residues	5028
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	199.9 Å
Rg (real space) rg_real	63.11 Å
Rg uncertainty (real space) rg_real_error	1.25 Å
I(0) (real space) i0_real	4.3120e+09
I(0) uncertainty (real space) i0_real_error	8.4380e+07
Rg (reciprocal space) rg_reciprocal	63.77 Å
I(0) (reciprocal space) i0_reciprocal	4316000000.0000
Solution quality estimate total_estimate	0.8282
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	80.0 Å
Skewness Skewness skewness	0.103
Kurtosis Kurtosis kurtosis	-0.577
Angular range angular_range	— – 0.1250 Å⁻¹
Current regularization parameter α current_alpha	0.0026
Highest regularization parameter α highest_alpha	319100000.0000
Real-space data points n_real_points	26
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.936; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.954; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Volume-regulated anion channel subunit LRRC8A
Molecular weight formula_weight	94239.4 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	41250

MIPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDKMICLPCKWVTKDSCNDSFRGWAASSPEPTYPNSTVLPTPDTGPTGIKYDLDRHQYNYVDAVCYENRLHWFAKYFPYLVLLHTLIFLACSNFWFKFPRTSSKLEHFVSILLKCFDSPWTTRALSETVVEESDPKPAFSKMNGSMDKKSSTVSEDVEATVPMLQRTKSRIEQGIVDRSETGVLDKKEGEQAKALFEKVKKFRTHVEEGDIVYRLYMRQTIIKVIKFALIICYTVYYVHNIKFDVDCTVDIESLTGYRTYRCAHPLATLFKILASFYISLVIFYGLICMYTLWWMLRRSLKKYSFESIREESSYSDIPDVKNDFAFMLHLIDQYDPLYSKRFAVFLSEVSENKLRQLNLNNEWTLDKLRQRLTKNAQDKLELHLFMLSGIPDTVFDLVELEVLKLELIPDVTIPPSIAQLTGLKELWLYHTAAKIEAPALAFLRENLRALHIKFTDIKEIPLWIYSLKTLEELHLTGNLSAENNRYIVIDGLRELKRLKVLRLKSNLSKLPQVVTDVGVHLQKLSINNEGTKLIVLNSLKKMVNLTELELIRCDLERIPHSIFSLHNLQEIDLKDNNLKTIEEIISFQHLHRLTCLKLWYNHIAYIPIQIGNLTNLERLYLNRNKIEKIPTQLFYCRKLRYLDLSHNNLTFLPADIGLLQNLQNLAVTANRIEALPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFSTLPPEVKERLWRADKEQA

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	Mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	synthetic nanobody Sb2
Molecular weight formula_weight	16748.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,G,H,I,J

GSSSQVQLVESGGGLVQAGGSLRLSCAASGFPVYQAWMWWYRQAPGKEREWVAAIESEGQYTWYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDTGHTTNQYDYWGQGTQVTVSAGRAGEQKLISEEDLNSAVDHHHHHH

来源 Source

来源生物 organism	synthetic construct
NCBI Class编号 ncbi_taxonomy_id	32630
宿主生物 host_organism	Escherichia coli MC1061

▼

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	7p5wG01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7p5wH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7p5wI01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7p5wJ01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7p5wK01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7p5wL01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	64959

fit	/app/data/saxs_computation/p5/7p5w/7p5w.fit
pddf	/app/data/pr_computation/p5/7p5w/7p5w.pr.out
profile	/app/data/saxs_computation/p5/7p5w/7p5w.dat

Structure of homomeric LRRC8A Volume-Regulated Anion Channel in complex with synthetic nanobody Sb2

1. Protein Identity and Related Structures Protein Identity & Related Structures

Volume-regulated anion channel subunit LRRC8A

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)