7r6q

State E2 nucleolar 60S ribosome biogenesis intermediate - Foot region model

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP-dependent RNA helicase HAS1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 60S ribosomal protein L8-A × 1 （P17076） Proteasome-interacting protein CIC1 × 1 （P38779） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein 15 × 1 （P53927） Ribosome biogenesis protein RLP7 × 1 （P40693） 60S ribosomal protein L25 × 1 （P04456） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745） 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HAS1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–505； UniProt 1–505

60S ribosomal protein L8-A

OrganismNot specified

UniProt P17076

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） Proteasome-interacting protein CIC1 × 1 （P38779） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein 15 × 1 （P53927） Ribosome biogenesis protein RLP7 × 1 （P40693） 60S ribosomal protein L25 × 1 （P04456） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745） 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL8A_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–256； UniProt 1–256

Proteasome-interacting protein CIC1

OrganismNot specified

UniProt P38779

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） 60S ribosomal protein L8-A × 1 （P17076） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein 15 × 1 （P53927） Ribosome biogenesis protein RLP7 × 1 （P40693） 60S ribosomal protein L25 × 1 （P04456） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745） 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CIC1_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–376； UniProt 1–376

Pescadillo homolog

OrganismNot specified

UniProt P53261

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） 60S ribosomal protein L8-A × 1 （P17076） Proteasome-interacting protein CIC1 × 1 （P38779） Ribosome biogenesis protein 15 × 1 （P53927） Ribosome biogenesis protein RLP7 × 1 （P40693） 60S ribosomal protein L25 × 1 （P04456） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745） 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PESC_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain n； PDBConstruct 1–605； UniProt 1–605

Ribosome biogenesis protein 15

OrganismNot specified

UniProt P53927

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） 60S ribosomal protein L8-A × 1 （P17076） Proteasome-interacting protein CIC1 × 1 （P38779） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein RLP7 × 1 （P40693） 60S ribosomal protein L25 × 1 （P04456） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745） 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NOP15_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain o； PDBConstruct 1–220； UniProt 1–220

Ribosome biogenesis protein RLP7

OrganismNot specified

UniProt P40693

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） 60S ribosomal protein L8-A × 1 （P17076） Proteasome-interacting protein CIC1 × 1 （P38779） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein 15 × 1 （P53927） 60S ribosomal protein L25 × 1 （P04456） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745） 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RLP7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain t； PDBConstruct 1–322； UniProt 1–322

60S ribosomal protein L25

OrganismNot specified

UniProt P04456

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） 60S ribosomal protein L8-A × 1 （P17076） Proteasome-interacting protein CIC1 × 1 （P38779） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein 15 × 1 （P53927） Ribosome biogenesis protein RLP7 × 1 （P40693） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745） 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL25_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain X； PDBConstruct 1–142； UniProt 1–142

Ribosome biogenesis protein ERB1

OrganismNot specified

UniProt Q04660

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） 60S ribosomal protein L8-A × 1 （P17076） Proteasome-interacting protein CIC1 × 1 （P38779） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein 15 × 1 （P53927） Ribosome biogenesis protein RLP7 × 1 （P40693） 60S ribosomal protein L25 × 1 （P04456） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745） 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ERB1_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain m； PDBConstruct 1–807； UniProt 1–807

Nucleolar protein 16

OrganismNot specified

UniProt P40007

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） 60S ribosomal protein L8-A × 1 （P17076） Proteasome-interacting protein CIC1 × 1 （P38779） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein 15 × 1 （P53927） Ribosome biogenesis protein RLP7 × 1 （P40693） 60S ribosomal protein L25 × 1 （P04456） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745） 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NOP16_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain v； PDBConstruct 1–231； UniProt 1–231

60S ribosomal protein L15-A

OrganismNot specified

UniProt P05748

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） 60S ribosomal protein L8-A × 1 （P17076） Proteasome-interacting protein CIC1 × 1 （P38779） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein 15 × 1 （P53927） Ribosome biogenesis protein RLP7 × 1 （P40693） 60S ribosomal protein L25 × 1 （P04456） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745） 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15A_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain N； PDBConstruct 1–204； UniProt 1–204

60S ribosomal protein L36-A

OrganismNot specified

UniProt P05745

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） 60S ribosomal protein L8-A × 1 （P17076） Proteasome-interacting protein CIC1 × 1 （P38779） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein 15 × 1 （P53927） Ribosome biogenesis protein RLP7 × 1 （P40693） 60S ribosomal protein L25 × 1 （P04456） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L13-A × 1 （Q12690）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL36A_YEAST
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain i； PDBConstruct 1–100； UniProt 1–100

60S ribosomal protein L13-A

OrganismNot specified

UniProt Q12690

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 16 RNA 3	ITS-2 × 1 ATP-dependent RNA helicase HAS1 × 1 （Q03532） 60S ribosomal protein L8-A × 1 （P17076） Proteasome-interacting protein CIC1 × 1 （P38779） Pescadillo homolog × 1 （P53261） Ribosome biogenesis protein 15 × 1 （P53927） Ribosome biogenesis protein RLP7 × 1 （P40693） 60S ribosomal protein L25 × 1 （P04456） Ribosome biogenesis protein ERB1 × 1 （Q04660） 25S rRNA × 1 Nucleolar protein 16 × 1 （P40007） 5.8S rRNA × 1 60S ribosomal protein L15-A × 1 （P05748） 60S ribosomal protein L35 × 1 60S ribosomal protein L27 × 1 60S ribosomal protein L34-A × 1 60S ribosome biogenesis factor Spb1 × 1 60S ribosomal protein L36-A × 1 （P05745）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL13A_YEAST
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain L； PDBConstruct 1–199； UniProt 1–199

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7r6q
Deposition date deposition_date	2021-06-23
Structure title title	State E2 nucleolar 60S ribosome biogenesis intermediate - Foot region model
Keywords keywords	ribosome biogenesis, DEAD-box ATPase, methyltransferase, nucleolus, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7r6q__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7r6q__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7r6q__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.71 Å
Rg (electron density)	52.71 Å
Total Rg	52.88 Å
Atom count	29033
Residues	2862
Excluded volume	486790 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7r6q__assembly_1__model_1`	nonadecameric （19）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	ITS-2
Molecular weight formula_weight	27786.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6
Atom count atom_count	29033

CCUUCUCAAACAUUCUGUUUGGUAGUGAGUGAUACUCUUUGGAGUUAACUUGAAAUUGCUGGCCUUUAGGCGAACAAUGUUCUUAAA

Entity 2 Entity 2 polymer

Description description	ATP-dependent RNA helicase HAS1
Molecular weight formula_weight	56798.3 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MATPSNKRSRDSESTEEPVVDEKSTSKQNNAAPEGEQTTCVEKFEELKLSQPTLKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELLHSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDKRFLLLFSFLKRNQKKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPNELGFLRYLKASKVPLNEYEFPENKIANVQSQLEKLIKSNYYLHQTAKDGYRSYLQAYASHSLKTVYQIDKLDLAKVAKSYGFPVPPKVNITIGASGKTPNTKRRKTHK

Entity 3 Entity 3 polymer

Description description	60S ribosomal protein L8-A
Molecular weight formula_weight	28175.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAPGKKVAPAPFGAKSTKSNKTRNPLTHSTPKNFGIGQAVQPKRNLSRYVKWPEYVRVQRQKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERLTKEAAAVAEGKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDPIELVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEAALAKLVSTIDANFADKYDEVKKHWGGGILGNKAQAKMDKRAKNSDSA

Entity 4 Entity 4 polymer

Description description	Proteasome-interacting protein CIC1
Molecular weight formula_weight	42596.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MAKKSNSKKSTPVSTPSKEKKKVIEKKSSTAIPRERVIKAVNELIKFTSKPQDENNEEGNNGKKNLLEDDEEELKKDLQLIVVNNKSFTGTSKSFKLKLLNVKHSFYKPWKEASATAVKDFKVLLILKDSDIKKVSEDDLFDQLDSEGIKVDEIICGKDLKTVYKAYEARNAFISQFSLILADDSIVTSLPKLMGGKAYNKVETTPISIRTHANKEFSLTTLTNNIKKVYMNQLPVKLPRGTTLNVHLGNLEWLRPEEFVDNVELISEQLIKAYQIRSIFIKTNRSPVLPLYYNQDVLDELEAKKDKIEETHEDDMVTIDGVQVHLSTFNKGLMEIANPSELGSIFSKQINNAKKRSSSELEKESSESEAVKKAKS

Entity 5 Entity 5 polymer

Description description	Pescadillo homolog
Molecular weight formula_weight	69984.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MRIKKKNTRGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPREPRNKKKANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVSSAKRLEENRDSYTLDHIIKERYPSFPDAIRDIDDALNMLFLFSNLPSTNQVSSKIINDAQKICNQWLAYVAKERLVRKVFVSIKGVYYQANIKGEEVRWLVPFKFPENIPSDVDFRIMLTFLEFYSTLLHFVLYKLYTDSGLIYPPKLDLKKDKIISGLSSYILESRQEDSLLKLDPTEIEEDVKVESLDASTLKSALNADEANTDETEKEEEQEKKQEKEQEKEQNEETELDTFEDNNKNKGDILIQPSKYDSPVASLFSAFVFYVSREVPIDILEFLILSCGGNVISEAAMDQIENKKDIDMSKVTHQIVDRPVLKNKVAGRTYIQPQWIFDCINKGELVPANKYLPGEALPPHLSPWGDAIGYDPTAPVEEGEEEESESESESEDQVEEEDQEVVAGEEDDDDDEELQAQKELELEAQGIKYSETSEADKDVNKSKNKKRKVDEEEEEKKLKMIMMSNKQKKLYKKMKYSNAKKEEQAENLKKKKKQIAKQKAKLNKLDSKK

Entity 6 Entity 6 polymer

Description description	Ribosome biogenesis protein 15
Molecular weight formula_weight	25499.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MVKSTSKTSTKETVTKQPTEEKPIQEKEELALETSSSSSDEEDEKDEDEIEGLAASDDEQSGTHKIKRLNPKKQANEKKSKDKKTLEEYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEKGITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW

Entity 7 Entity 7 polymer

Description description	Ribosome biogenesis protein RLP7
Molecular weight formula_weight	36621.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MSSTQDSKAQTLNSNPEILLRKRRNADRTRIERQELAKKKREEQIKKKRSNKNKFVRAESIVAKTLATSREKERIKRVSILEDKKAKNETQHIASGKDFILKITEKANGAEENSVDLEETEEEEDDGLIREKTTYDGKPALLFIVRVRGPLAVNIPNKAFKILSLLRLVETNTGVFVKLTKNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIVEEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGFGSLNRLRKIKQREAESRTRQFSNAATAPVIEVDIDSLLAKLN

Entity 8 Entity 8 polymer

Description description	60S ribosomal protein L25
Molecular weight formula_weight	15787.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSYKVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTKKAYVRLTADYDALDIANRIGYI

Entity 9 Entity 9 polymer

Description description	Ribosome biogenesis protein ERB1
Molecular weight formula_weight	91830.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

MMAKNNKTTEAKMSKKRAASEESDVEEDEDKLLSVDGLIDAEASESDEDDDEYESAVEEKESSSDKEAQDDSDDDSDAELNKLLAEEEGDGEEDYDSSEFSDDTTSLTDRLSGVKLQTIVDPNIYSKYADGSDRIIKPEINPVYDSDDSDAETQNTIGNIPLSAYDEMPHIGYDINGKRIMRPAKGSALDQLLDSIELPEGWTGLLDKNSGSSLNLTKEELELISKIQRNEQTDDSINPYEPLIDWFTRHEEVMPLTAVPEPKRRFVPSKNEAKRVMKIVRAIREGRIIPPKKLKEMKEKEKIENYQYDLWGDSTETNDHVMHLRAPKLPPPTNEESYNPPEEYLLSPEEKEAWENTEYSERERNFIPQKYSALRKVPGYGESIRERFERSLDLYLAPRVRKNKLNIDPNSLIPELPSPKDLRPFPIRCSTIYAGHKGKVRTLSIDPSGLWLATGSDDGTVRVWEILTGREVYRTTLIDDEENPDYHIECIEWNPDANNGILAVAVGENIHLIVPPIFGYDIENNGKTKIEDGFGYDTFGTVKKSNLEVNENGDGDEDGENESAKNAVKKQVAQWNKPSQKQLEKDICITISCKKTVKKLSWHRKGDYFVTVQPDSGNTSVLIHQVSKHLTQSPFKKSKGIIMDAKFHPFKPQLFVCSQRYVRIYDLSQQILVKKLLPGARWLSKIDIHPRGDNLIASSFDKRVLWHDLDLASTPYKTLRYHEKAVRSVNFHKKLPLFSSAADDGTIHVFHATVYDDMMKNPMIVPLKKLTGHKVINSLGVLDAIWHPREAWLFSAGADNTARLWTT

Entity 10 Entity 10 polymer

Description description	25S rRNA
Molecular weight formula_weight	95192.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	1

GUUUGACCUCAAAUCAGGUAGGAAAGCUCAAAUUUGAAAUCUGGUACCUUCGGUGCCCGAGUUGUAAUUUGGAGAGGGCAACUUUGGGUUUGUAAAGUGCCUUCGAAGAGUCGCUAAGUGGGUGGUCCAUCUAAAGCUAAUAGUCGAUCCUAAGAGAUGGGGAAGCUCCGUUUCAAAGGCCUGAUUUUAUGCAGGCCACCAUCGAAAGGGAAUCCUUCCGGAACCUGGAUAUGGAUUCUUCACACUGAAUGUGGAGAAAAUCCACAGGAAGGAAUAGUUUUCAUGCCAGGUCGUA

Entity 11 Entity 11 polymer

Description description	Nucleolar protein 16
Molecular weight formula_weight	26954.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MTSVRKRKMNRSSVGKATRRNKDKQRKINIQSNPIIAANWDYSLTMAQNYKKLGLRAKLQTPAGGKEADLSKVVKRIPLTKPVLDEDEDEDEGEDEQNDYNAATVELDENEIPEGGARIQRDKNGDVVRVVYGKKKNFDADEDVNEIKARDTTEETEVVKKLEELASRPVIRKERSQSEREEEWLEKLYKKHGDDYKKMFFDKKLNIYQQSEGDLKRRLLRWKKRNGIASK

Entity 12 Entity 12 polymer

Description description	5.8S rRNA
Molecular weight formula_weight	18223.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

UGAACGCACAUUGCGCCCCUUGGUAUUCCAGGGGGCAUGCCUGUUUGAGCGUCAUUU

Entity 13 Entity 13 polymer

Description description	60S ribosomal protein L15-A
Molecular weight formula_weight	24482.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRLGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRATAEERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPQHKAIRRDARYNWICDPVHKHREARGLTATGKKSRGINKGHKFNNTKAGRRKTWKRQNTLSLWRYRK

Entity 14 Entity 14 polymer

Description description	60S ribosomal protein L35
Molecular weight formula_weight	2165.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

GKKYQPKVTEKQRKKQIA

Entity 15 Entity 15 polymer

Description description	60S ribosomal protein L27
Molecular weight formula_weight	1801.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

LKVTKKHGAKKVAKRT

Entity 16 Entity 16 polymer

Description description	60S ribosomal protein L34-A
Molecular weight formula_weight	4511.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

FRRRNHVKKLATISTLRPRQYATVSKTHKTALQAYGGSR

Entity 17 Entity 17 polymer

Description description	60S ribosome biogenesis factor Spb1
Molecular weight formula_weight	8182.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MIKDKDSAADADDLESELNAMYSDYKTRRSERDAKFRVDEGFNRYTFRDTENLPDWFLEDEKEHSKIN

Entity 18 Entity 18 polymer

Description description	60S ribosomal protein L36-A
Molecular weight formula_weight	11151.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MTVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH

Entity 19 Entity 19 polymer

Description description	60S ribosomal protein L13-A
Molecular weight formula_weight	22604.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPATDVEARAVQDNGESAFRTLRLARSEKKFRGIREKRAREKAEAEAEKKK

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	7r6qN01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1120 — Ribosomal protein L15e
Homologous superfamily homologous superfamily	10 — Ribosomal protein L15

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.98 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	198000

State E2 nucleolar 60S ribosome biogenesis intermediate - Foot region model

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP-dependent RNA helicase HAS1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

60S ribosomal protein L8-A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome-interacting protein CIC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pescadillo homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosome biogenesis protein 15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosome biogenesis protein RLP7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

60S ribosomal protein L25

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosome biogenesis protein ERB1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleolar protein 16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

60S ribosomal protein L15-A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer