SAXSdb — 7rzr

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;SARS-CoV-2 HR1 D936Y linked to a scaffold,Spike protein S2' ;

Severe acute respiratory syndrome coronavirus 2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	;Spike protein S2' ; × 3 （P0DTC2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2J981_NOSP7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 11–184； UniProt 5–178 Author chain B； PDBConstruct 11–184； UniProt 5–178 Author chain C； PDBConstruct 11–184； UniProt 5–178

;SARS-CoV-2 HR1 D936Y linked to a scaffold,Spike protein S2' ;

Severe acute respiratory syndrome coronavirus 2

UniProt P0DTC2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6	No other associated polymer	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPIKE_SARS2
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 186–257； UniProt 917–988 Author chain B； PDBConstruct 186–257； UniProt 917–988 Author chain C； PDBConstruct 186–257； UniProt 917–988 Author chain D； PDBConstruct 2–41； UniProt 1162–1201 Author chain E； PDBConstruct 2–41； UniProt 1162–1201 Author chain F； PDBConstruct 2–41； UniProt 1162–1201

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7rzr
Deposition date deposition_date	2021-08-27
Structure title title	Cryo-EM structure of the SARS-CoV-2 HR1HR2 fusion core complex with D936Y mutation
Keywords keywords	spike, HR1HR2, fusion, D936Y, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7rzr__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7rzr__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7rzr__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.03 Å
Rg (electron density)	29.63 Å
Total Rg	29.74 Å
Atom count	2448
Residues	324
Excluded volume	43632 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7rzr__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	;SARS-CoV-2 HR1 D936Y linked to a scaffold,Spike protein S2' ;
Molecular weight formula_weight	28807.1 kDa
Mutation mutation	D936Y
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	2448

MSHHHHHHGSQTLLRNFGNVYDNPVLLDRSVTAPVTEGFNVVLASFQALYLQYQKHHFVVEGSEFYSLHEFFNESYNQVQDHIHEIGERLDGLGGVPVATFSKLAELTCFEQESEGVYSSRQMVENDLAAEQAIIGVIRRQAAQAESLGDRGTRYLYEKILLKTEERAYHLSHFLAKDSLTLGFAYENQKLIANQFNSAIGKIQYSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVE

Source Source

Source organism organism	Severe acute respiratory syndrome coronavirus 2
Common name common_name	2019-nCoV, SARS-CoV-2
NCBI taxonomy ID ncbi_taxonomy_id	2697049
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;Spike protein S2' ;
Molecular weight formula_weight	4422.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

GPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQ

Source Source

Source organism organism	Severe acute respiratory syndrome coronavirus 2
Common name common_name	2019-nCoV, SARS-CoV-2
NCBI taxonomy ID ncbi_taxonomy_id	2697049
Host organism host_organism	Escherichia coli

▶

Resolution resolution	2.27 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	585122

Cryo-EM structure of the SARS-CoV-2 HR1HR2 fusion core complex with D936Y mutation

1. Protein Identity and Related Structures Protein Identity & Related Structures

;SARS-CoV-2 HR1 D936Y linked to a scaffold,Spike protein S2' ;

State in the Current Structure

Other States of the Same Protein in the Database

;SARS-CoV-2 HR1 D936Y linked to a scaffold,Spike protein S2' ;

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7rzr__assembly_1__model_1

7rzr__assembly_1__model_1 | I(q)

7rzr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Cryo-EM structure of the SARS-CoV-2 HR1HR2 fusion core complex with D936Y mutation

1. Protein Identity and Related Structures Protein Identity & Related Structures

;SARS-CoV-2 HR1 D936Y linked to a scaffold,Spike protein S2' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;SARS-CoV-2 HR1 D936Y linked to a scaffold,Spike protein S2' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7rzr__assembly_1__model_1

7rzr__assembly_1__model_1 | I(q)

7rzr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)