7ylw

yeast TRiC-plp2-tubulin complex at S3 closed TRiC state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-complex protein 1 subunit alpha

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit gamma × 2 （P39077） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit theta × 2 （P47079） Tubulin beta chain × 1 （A0A6A5PXT5） T-complex protein 1 subunit zeta × 2 （P39079） Phosducin-like protein 2 × 1 （Q12017） ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16 ALUMINUM FLUORIDE × 14 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPA_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–559； UniProt 1–559 Author chain a； PDBConstruct 1–559； UniProt 1–559

T-complex protein 1 subunit beta

Saccharomyces cerevisiae

UniProt P39076

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit gamma × 2 （P39077） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit theta × 2 （P47079） Tubulin beta chain × 1 （A0A6A5PXT5） T-complex protein 1 subunit zeta × 2 （P39079） Phosducin-like protein 2 × 1 （Q12017） ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16 ALUMINUM FLUORIDE × 14 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPB_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–527； UniProt 1–527 Author chain b； PDBConstruct 1–527； UniProt 1–527

T-complex protein 1 subunit delta

Saccharomyces cerevisiae

UniProt P39078

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit gamma × 2 （P39077） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit theta × 2 （P47079） Tubulin beta chain × 1 （A0A6A5PXT5） T-complex protein 1 subunit zeta × 2 （P39079） Phosducin-like protein 2 × 1 （Q12017） ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16 ALUMINUM FLUORIDE × 14 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPD_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–528； UniProt 1–528 Author chain d； PDBConstruct 1–528； UniProt 1–528

T-complex protein 1 subunit epsilon

Saccharomyces cerevisiae

UniProt P40413

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit gamma × 2 （P39077） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit theta × 2 （P47079） Tubulin beta chain × 1 （A0A6A5PXT5） T-complex protein 1 subunit zeta × 2 （P39079） Phosducin-like protein 2 × 1 （Q12017） ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16 ALUMINUM FLUORIDE × 14 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPE_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–562； UniProt 1–562 Author chain e； PDBConstruct 1–562； UniProt 1–562

T-complex protein 1 subunit gamma

Saccharomyces cerevisiae

UniProt P39077

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit theta × 2 （P47079） Tubulin beta chain × 1 （A0A6A5PXT5） T-complex protein 1 subunit zeta × 2 （P39079） Phosducin-like protein 2 × 1 （Q12017） ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16 ALUMINUM FLUORIDE × 14 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPG_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–374； UniProt 1–374 Author chain G； PDBConstruct 436–594； UniProt 376–534 Author chain g； PDBConstruct 1–374； UniProt 1–374 Author chain g； PDBConstruct 436–594； UniProt 376–534

T-complex protein 1 subunit eta

Saccharomyces cerevisiae

UniProt P42943

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit gamma × 2 （P39077） T-complex protein 1 subunit theta × 2 （P47079） Tubulin beta chain × 1 （A0A6A5PXT5） T-complex protein 1 subunit zeta × 2 （P39079） Phosducin-like protein 2 × 1 （Q12017） ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16 ALUMINUM FLUORIDE × 14 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPH_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–550； UniProt 1–550 Author chain h； PDBConstruct 1–550； UniProt 1–550

T-complex protein 1 subunit theta

Saccharomyces cerevisiae

UniProt P47079

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit gamma × 2 （P39077） T-complex protein 1 subunit eta × 2 （P42943） Tubulin beta chain × 1 （A0A6A5PXT5） T-complex protein 1 subunit zeta × 2 （P39079） Phosducin-like protein 2 × 1 （Q12017） ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16 ALUMINUM FLUORIDE × 14 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPQ_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Q； PDBConstruct 1–568； UniProt 1–568 Author chain q； PDBConstruct 1–568； UniProt 1–568

Tubulin beta chain

Saccharomyces cerevisiae

UniProt A0A6A5PXT5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit gamma × 2 （P39077） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit theta × 2 （P47079） T-complex protein 1 subunit zeta × 2 （P39079） Phosducin-like protein 2 × 1 （Q12017） ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16 ALUMINUM FLUORIDE × 14 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PXT5_YEASX
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain T； PDBConstruct 1–457； UniProt 1–457

T-complex protein 1 subunit zeta

Saccharomyces cerevisiae

UniProt P39079

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit gamma × 2 （P39077） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit theta × 2 （P47079） Tubulin beta chain × 1 （A0A6A5PXT5） Phosducin-like protein 2 × 1 （Q12017） ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16 ALUMINUM FLUORIDE × 14 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TCPZ_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Z； PDBConstruct 1–546； UniProt 1–546 Author chain z； PDBConstruct 1–546； UniProt 1–546

Phosducin-like protein 2

Saccharomyces cerevisiae

UniProt Q12017

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	T-complex protein 1 subunit alpha × 2 （P12612） T-complex protein 1 subunit beta × 2 （P39076） T-complex protein 1 subunit delta × 2 （P39078） T-complex protein 1 subunit epsilon × 2 （P40413） T-complex protein 1 subunit gamma × 2 （P39077） T-complex protein 1 subunit eta × 2 （P42943） T-complex protein 1 subunit theta × 2 （P47079） Tubulin beta chain × 1 （A0A6A5PXT5） T-complex protein 1 subunit zeta × 2 （P39079） ADENOSINE-5'-DIPHOSPHATE × 16 MAGNESIUM ION × 16 ALUMINUM FLUORIDE × 14 GUANOSINE-5'-TRIPHOSPHATE × 1 water × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLP2_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain p； PDBConstruct 1–286； UniProt 1–286

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ylw
Deposition date deposition_date	2022-07-27
Structure title title	yeast TRiC-plp2-tubulin complex at S3 closed TRiC state
Keywords keywords	TRiC/CCT, tubulin, phosducin-like protein, CHAPERONE; CHAPERONE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ylw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ylw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ylw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	65.00 Å
Rg (electron density)	63.96 Å
Total Rg	64.13 Å
Atom count	70324
Residues	9105
Excluded volume	1257900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ylw__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	T-complex protein 1 subunit alpha
Molecular weight formula_weight	60557.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a
Atom count atom_count	70338

MSQLFNNSRSDTLFLGGEKISGDDIRNQNVLATMAVANVVKSSLGPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVLSTSVDTLGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAVKTQNSKGEIKYPVKAVNVLKAHGKSATESLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIRKREAGIVLERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLEGEETFESSYLGLCDEVVQAKFSDDECILIKGTSKHSSSSIILRGANDYSLDEMERSLHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSSELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACVAILRIDTMITVDPEPPKEDPHDH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 2 Entity 2 polymer

Description description	T-complex protein 1 subunit beta
Molecular weight formula_weight	57276.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

MSVQIFGDQVTEERAENARLSAFVGAIAVGDLVKSTLGPKGMDKLLQSASSNTCMVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAELLREAEKLIDQSKIHPQTIIEGYRLASAAALDALTKAAVDNSHDKTMFREDLIHIAKTTLSSKILSQDKDHFAELATNAILRLKGSTNLEHIQIIKILGGKLSDSFLDEGFILAKKFGNNQPKRIENAKILIANTTLDTDKVKIFGTKFKVDSTAKLAQLEKAEREKMKNKIAKISKFGINTFINRQLIYDYPEQLFTDLGINSIEHADFEGVERLALVTGGEVVSTFDEPSKCKLGECDVIEEIMLGEQPFLKFSGCKAGEACTIVLRGATDQTLDEAERSLHDALSVLSQTTKETRTVLGGGCAEMVMSKAVDTEAQNIDGKKSLAVEAFARALRQLPTILADNAGFDSSELVSKLRSSIYNGISTSGLDLNNGTIADMRQLGIVESYKLKRAVVSSASEAAEVLLRVDNIIRARPRTANRQHM

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 3 Entity 3 polymer

Description description	T-complex protein 1 subunit delta
Molecular weight formula_weight	57682.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MSAKVPSNATFKNKEKPQEVRKANIIAARSVADAIRTSLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDILLEMCHKVSLSDREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVLKISDENSKNVDLNDIRLVKKVGGTIDDTEMIDGVVLTQTAIKSAGGPTRKEKAKIGLIQFQISPPKPDTENNIIVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLGSADLVEEIDSDGSKIVRVTGIRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRSKHENGELNDGISVRRSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDIAFSR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 4 Entity 4 polymer

Description description	T-complex protein 1 subunit epsilon
Molecular weight formula_weight	61995.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILKIDNVIISGKDEY

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 5 Entity 5 polymer

Description description	T-complex protein 1 subunit gamma
Molecular weight formula_weight	65423.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,g

MQAPVVFMNASQERTTGRQAQISNITAAKAVADVIRTCLGPKAMLKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEILAQCAPYLIEKNIHPVIIIQALKKALTDALEVIKQVSKPVDVENDAAMKKLIQASIGTKYVIHWSEKMCELALDAVKTVRKDLGQTVEGEPNFEIDIKRYVRVEKIPGGDVLDSRVLKGVLLNKDVVHPKMSRHIENPRVVLLDCPLEYKKGESQTNIEIEKEEDWNRILQIEEEQVQLMCEQILAVRPTLVITEKGVSDLAQHYLLKGGCSVLRRVKKSDNNRIARVTGATIVNRVEDLKESDVGTNCGLFKVEMIGDEYFSFLDNCKEPLEGSGSGWSHPQFEKGSGKRRWKKNFIAVSAANRFKKISSSGALGSGHHHHHHHHGSGLQKACTIMLRGGSKDILNEIDRNLQDAMAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQNAGGDPIRLLSQLRAKHAQGNFTTGIDGDKGKIVDMVSYGIWEPEVIKQQSVKTAIESACLLLRVDDIVSGVRKQE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 6 Entity 6 polymer

Description description	T-complex protein 1 subunit eta
Molecular weight formula_weight	59802.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

MNFGSQTPTIVVLKEGTDASQGKGQIISNINACVAVQEALKPTLGPLGSDILIVTSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVTILAGELMKEAKPFLEEGISSHLIMKGYRKAVSLAVEKINELAVDITSEKSSGRELLERCARTAMSSKLIHNNADFFVKMCVDAVLSLDRNDLDDKLIGIKKIPGGAMEESLFINGVAFKKTFSYAGFEQQPKKFNNPKILSLNVELELKAEKDNAEVRVEHVEDYQAIVDAEWQLIFEKLRQVEETGANIVLSKLPIGDLATQFFADRNIFCAGRVSADDMNRVIQAVGGSIQSTTSDIKPEHLGTCALFEEMQIGSERYNLFQGCPQAKTCTLLLRGGAEQVIAEVERSLHDAIMIVKRALQNKLIVAGGGATEMEVSKCLRDYSKTIAGKQQMIINAFAKALEVIPRQLCENAGFDAIEILNKLRLAHSKGEKWYGVVFETENIGDNFAKFVWEPALVKINALNSATEATNLILSVDETITNKGSESANAGMMPPQGAGRGRGMPM

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 7 Entity 7 polymer

Description description	T-complex protein 1 subunit theta
Molecular weight formula_weight	61735.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,q

MSLRLPQNPNAGLFKQGYNSYSNADGQIIKSIAAIRELHQMCLTSMGPCGRNKIIVNHLGKIIITNDAATMLRELDIVHPAVKVLVMATEQQKIDMGDGTNLVMILAGELLNVSEKLISMGLSAVEIIQGYNMARKFTLKELDEMVVGEITDKNDKNELLKMIKPVISSKKYGSEDILSELVSEAVSHVLPVAQQAGEIPYFNVDSIRVVKIMGGSLSNSTVIKGMVFNREPEGHVKSLSEDKKHKVAVFTCPLDIANTETKGTVLLHNAQEMLDFSKGEEKQIDAMMKEIADMGVECIVAGAGVGELALHYLNRYGILVLKVPSKFELRRLCRVCGATPLPRLGAPTPEELGLVETVKTMEIGGDRVTVFKQEQGEISRTSTIILRGATQNNLDDIERAIDDGVAAVKGLMKPSGGKLLPGAGATEIELISRITKYGERTPGLLQLAIKQFAVAFEVVPRTLAETAGLDVNEVLPNLYAAHNVTEPGAVKTDHLYKGVDIDGESDEGVKDIREENIYDMLATKKFAINVATEAATTVLSIDQIIMAKKAGGPRAPQGPRPGNWDQED

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 8 Entity 8 polymer

Description description	Tubulin beta chain
Molecular weight formula_weight	50967.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MREIIHISTGQCGNQIGAAFWETICGEHGLDFNGTYHGHDDIQKERLNVYFNEASSGKWVPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQYQEATVEDDEEVDENGDFGAPQNQDEPITENFE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 9 Entity 9 polymer

Description description	T-complex protein 1 subunit zeta
Molecular weight formula_weight	59997.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

MSLQLLNPKAESLRRDAALKVNVTSAEGLQSVLETNLGPKGTLKMLVDGAGNIKLTKDGKVLLTEMQIQSPTAVLIARAAAAQDEITGDGTTTVVCLVGELLRQAHRFIQEGVHPRIITDGFEIARKESMKFLDEFKISKTNLSNDREFLLQVARSSLLTKVDADLTEVLTPIVTDAVLSVYDAQADNLDLHMVEIMQMQHLSPKDTTFIKGLVLDHGGRHPDMPTRVKNAYVLILNVSLEYEKTEVNSGFFYSSADQRDKLAASERKFVDAKLKKIIDLKNEVCGMDPDKGFVIINQKGIDPMSLDVFAKHNILALRRAKRRNMERLQLVTGGEAQNSVEDLSPQILGFSGLVYQETIGEEKFTYVTENTDPKSCTILIKGSTHYALAQTKDAVRDGLRAVANVLKDKNIIPGAGAFYIALSRYLRSANMNKLGAKGKTKTGIEAFAEALLVIPKTLVKNSGFDPLDVLAMVEDELDDAQDSDETRYVGVDLNIGDSCDPTIEGIWDSYRVLRNAITGATGIASNLLLCDELLRAGRSTLKETPQ

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Saccharomyces cerevisiae

Entity 10 Entity 10 polymer

Description description	Phosducin-like protein 2
Molecular weight formula_weight	32836.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MQNEPMFQVQVDESEDSEWNDILRAKGVIPERAPSPTAKLEEALEEAIAKQHENRLEDKDLSDLEELEDDEDEDFLEAYKIKRLNEIRKLQERSKFGEVFHINKPEYNKEVTLASQGKKYEGAQTNDNGEEDDGGVYVFVHLSLQSKLQSRILSHLFQSAACKFREIKFVEIPANRAIENYPESNCPTLIVYYRGEVIKNMITLLELGGNNSKMEDFEDFMVKVGAVAEGDNRLIMNRDDEESREERKLHYGEKKSIRSGIRGKFNVGIGGNDDGNINDDDDGFFD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 12 Entity 12 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 13 Entity 13 non-polymer

Description description	ALUMINUM FLUORIDE
Molecular weight formula_weight	84.0 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 14 Entity 14 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 15 Entity 15 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	14

▼

6. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

Domain ID domain_id	7ylwB01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	7ylwD01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	7ylwH01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	7ylwQ01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	7ylwT01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1440 — Tubulin/FtsZ, GTPase domain

Domain ID domain_id	7ylwT02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	20 — Tubulin/FtsZ, C-terminal domain

Domain ID domain_id	7ylwT03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	600 — Helix hairpin bin

Domain ID domain_id	7ylwa01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	7ylwb01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	7ylwd01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

Domain ID domain_id	7ylwh01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	260 — GROEL; domain 2
Homologous superfamily homologous superfamily	10 — TCP-1-like chaperonin intermediate domain

Domain ID domain_id	7ylwq01
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	7 — GroEL
Homologous superfamily homologous superfamily	10 — GroEL

▶

Resolution resolution	3.39 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	28063

yeast TRiC-plp2-tubulin complex at S3 closed TRiC state

1. Protein Identity and Related Structures Protein Identity & Related Structures

T-complex protein 1 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit epsilon

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit gamma

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit eta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit theta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-complex protein 1 subunit zeta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phosducin-like protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer