SAXSdb — 8def

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spike glycoprotein E1

Western equine encephalitis virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 10 PDB declaration: decameric（10） Consistent with protein copy count	Chain A； UniProt 798–1236 Chain B； UniProt 320–737 Chain F； UniProt 798–1236 Chain G； UniProt 320–737 Chain J； UniProt 798–1236 Chain K； UniProt 320–737	Not recorded	SKW24 Fab heavy chain × 2 SKW24 Fab light chain × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8DEF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8DEC Cryo-EM Structure of Western Equine Encephalitis Virus Deposited 2022-06-20	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 720 PDB declaration: 720-meric	Chain A 798–1236（439 aa） Chain B 320–737（418 aa） Chain E 1–259（259 aa） Chain F 798–1236（439 aa） Chain G 320–737（418 aa） Chain I 1–259（259 aa） Chain J 798–1236（439 aa） Chain K 320–737（418 aa） Chain M 1–259（259 aa） Chain N 798–1236（439 aa） Chain O 320–737（418 aa） Chain R 1–259（259 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
8DEC Cryo-EM Structure of Western Equine Encephalitis Virus Deposited 2022-06-20	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 798–1236（439 aa） Chain B 320–737（418 aa） Chain E 1–259（259 aa） Chain F 798–1236（439 aa） Chain G 320–737（418 aa） Chain I 1–259（259 aa） Chain J 798–1236（439 aa） Chain K 320–737（418 aa） Chain M 1–259（259 aa） Chain N 798–1236（439 aa） Chain O 320–737（418 aa） Chain R 1–259（259 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
8DEC Cryo-EM Structure of Western Equine Encephalitis Virus Deposited 2022-06-20	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 60 PDB declaration: 60-meric	Chain A 798–1236（439 aa） Chain B 320–737（418 aa） Chain E 1–259（259 aa） Chain F 798–1236（439 aa） Chain G 320–737（418 aa） Chain I 1–259（259 aa） Chain J 798–1236（439 aa） Chain K 320–737（418 aa） Chain M 1–259（259 aa） Chain N 798–1236（439 aa） Chain O 320–737（418 aa） Chain R 1–259（259 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
8DEC Cryo-EM Structure of Western Equine Encephalitis Virus Deposited 2022-06-20	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 72 PDB declaration: 72-meric	Chain A 798–1236（439 aa） Chain B 320–737（418 aa） Chain E 1–259（259 aa） Chain F 798–1236（439 aa） Chain G 320–737（418 aa） Chain I 1–259（259 aa） Chain J 798–1236（439 aa） Chain K 320–737（418 aa） Chain M 1–259（259 aa） Chain N 798–1236（439 aa） Chain O 320–737（418 aa） Chain R 1–259（259 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
8DEC Cryo-EM Structure of Western Equine Encephalitis Virus Deposited 2022-06-20	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 798–1236（439 aa） Chain B 320–737（418 aa） Chain E 1–259（259 aa） Chain F 798–1236（439 aa） Chain G 320–737（418 aa） Chain I 1–259（259 aa） Chain J 798–1236（439 aa） Chain K 320–737（418 aa） Chain M 1–259（259 aa） Chain N 798–1236（439 aa） Chain O 320–737（418 aa） Chain R 1–259（259 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.70 Å
8DED Cryo-EM Structure of Western Equine Encephalitis Virus VLP in complex with SKW19 fab Deposited 2022-06-20	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 798–1236（439 aa） Chain B 320–737（418 aa） Chain F 798–1236（439 aa） Chain G 320–737（418 aa） Chain J 798–1236（439 aa） Chain K 320–737（418 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
8DEE Asymmetric Unit of Western Equine Encephalitis Virus Deposited 2022-06-20	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 798–1236（439 aa） Chain B 320–737（418 aa） Chain E 1–259（259 aa） Chain F 798–1236（439 aa） Chain G 320–737（418 aa） Chain I 1–259（259 aa） Chain J 798–1236（439 aa） Chain K 320–737（418 aa） Chain M 1–259（259 aa） Chain N 798–1236（439 aa） Chain O 320–737（418 aa） Chain R 1–259（259 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8DUL Cryo-EM Structure of Antibody SKT05 in complex with Western Equine Encephalitis Virus spike (local refinement from VLP particles) Deposited 2022-07-27	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 8 PDB declaration: octameric	Chain A 738–1226（489 aa） Chain B 330–737（408 aa） Chain F 738–1226（489 aa） Chain G 330–737（408 aa） Chain J 738–1226（489 aa） Chain K 330–737（408 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.17 Å
8DUN Cryo-EM Structure of Antibody SKW11 in complex with Western Equine Encephalitis Virus spike (local refinement from VLP particles) Deposited 2022-07-27	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 738–1226（489 aa） Chain B 330–737（408 aa） Chain F 738–1226（489 aa） Chain G 330–737（408 aa） Chain J 738–1226（489 aa） Chain K 330–737（408 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.84 Å
9DQV Structure of western equine encephalitis virus CBA87 VLP in complex with human PCDH10 EC1 Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: 16-meric	Chain C 97–259（163 aa） Chain F 97–259（163 aa） Chain I 97–259（163 aa） Chain L 97–259（163 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9DQX Structure of western equine encephalitis virus CBA87 VLP Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: 12-meric	Chain C 97–259（163 aa） Chain F 97–259（163 aa） Chain I 97–259（163 aa） Chain L 97–259（163 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
9DQY Structure of western equine encephalitis virus Imperial 181 VLP in complex with house sparrow PCDH10 EC1 Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 798–1231（434 aa） Chain C 798–1231（434 aa） Chain E 798–1231（434 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
9DQZ Structure of western equine encephalitis virus McMillan VLP in complex with human VLDLR Deposited 2024-09-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: 16-meric	Chain C 102–259（158 aa） Chain F 102–259（158 aa） Chain I 102–259（158 aa） Chain L 102–259（158 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 16 CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9E96 WEEV CBA87 VLP in complex with human PCDH10-EC1 Deposited 2024-11-07	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: 16-meric	Chain E 107–259（153 aa） Chain I 107–259（153 aa） Chain M 107–259（153 aa） Chain R 107–259（153 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.05 Å
9E9Y WEEV McMillan VLP in complex with VLDLR LA(1-2) Deposited 2024-11-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: 16-meric	Chain A 798–1236（439 aa） Chain C 798–1236（439 aa） Chain E 107–259（153 aa） Chain F 107–259（153 aa） Chain G 798–1236（439 aa） Chain I 107–259（153 aa） Chain J 798–1236（439 aa） Chain L 107–259（153 aa）	Not recorded	CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.96 Å
9E9Z SINV-WEEV Fleming in complex with VLDLR LA(1-2) Deposited 2024-11-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: 16-meric	Chain E 107–259（153 aa） Chain F 107–259（153 aa） Chain I 107–259（153 aa） Chain L 107–259（153 aa）	Not recorded	CA CALCIUM ION × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.95 Å
9L99 Structure of Western equine encephalitis virus McMillan strain in complex with VLDLR LA1-2 Deposited 2024-12-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 798–1208（411 aa） Chain B 321–689（369 aa） Chain G 798–1208（411 aa） Chain H 321–689（369 aa）	Not recorded	CA CALCIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9L9A Structure of Western equine encephalitis virus McMillan strain in complex with VLDLR LA2-3 Deposited 2024-12-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 798–1208（411 aa） Chain B 321–689（369 aa） Chain G 798–1208（411 aa） Chain H 321–689（369 aa）	Not recorded	CA CALCIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
9UIH CryoEM structure of Western equine encephalitis virus California VLP Deposited 2025-04-15	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 798–1236（439 aa） Chain B 320–737（418 aa） Chain C 798–1236（439 aa） Chain D 320–737（418 aa） Chain E 798–1236（439 aa） Chain F 320–737（418 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.05 Å
9UIO CryoEM structure of Western equine encephalitis virus California VLP in complex with VLDLR-LA1-3 Deposited 2025-04-15	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 798–1236（439 aa） Chain B 320–737（418 aa） Chain C 798–1236（439 aa） Chain D 320–737（418 aa） Chain E 798–1236（439 aa） Chain F 320–737（418 aa）	Not recorded	CA CALCIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.03 Å
9WSL CryoEM structure of Western equine encephalitis virus California VLP in complex with VLDLR-LBD Deposited 2025-09-13	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 798–1236（439 aa） Chain B 320–737（418 aa） Chain C 798–1236（439 aa） Chain D 320–737（418 aa） Chain E 798–1236（439 aa） Chain F 320–737（418 aa）	Not recorded	CA CALCIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.27 Å

17 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POLS_WEEV
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–439； UniProt 798–1236 Author chain F； PDBConstruct 1–439； UniProt 798–1236 Author chain J； PDBConstruct 1–439； UniProt 798–1236 Author chain B； PDBConstruct 1–418； UniProt 320–737 Author chain G； PDBConstruct 1–418； UniProt 320–737 Author chain K； PDBConstruct 1–418； UniProt 320–737

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8def
Deposition date deposition_date	2022-06-20
Structure title title	Cryo-EM Structure of Western Equine Encephalitis Virus VLP in complex with SKW24 fab
Keywords keywords	Western Equine Encephalitis Virus, virus-like particle, antibody, VLP-Fab complex, VIRUS-IMMUNE SYSTEM complex; VIRUS/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	53.09 Å
Radius of gyration Rg (electron density) rg_electron	52.90 Å
Forward intensity I(0) i0	1227340000.00
Molecular weight molecular_weight	288700.0 kDa
Excluded volume excluded_volume	359900 Å³
Envelope volume envelope_volume	513480 Å³
Hydration-shell volume shell_volume	83763 Å³
Envelope diameter envelope_diameter	186.8 Å
Shell Rg shell_rg	53.17 Å
Envelope Rg envelope_rg	51.76 Å
Shape Rg shape_rg	52.88 Å
Total Rg total_rg	52.99 Å
Total atoms total_atoms	20314
Residues n_residues	2638
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	176.3 Å
Rg (real space) rg_real	53.02 Å
Rg uncertainty (real space) rg_real_error	2.21 Å
I(0) (real space) i0_real	1.2270e+09
I(0) uncertainty (real space) i0_real_error	2.5370e+07
Rg (reciprocal space) rg_reciprocal	53.14 Å
I(0) (reciprocal space) i0_reciprocal	1228000000.0000
Solution quality estimate total_estimate	0.8785
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	64.7 Å
Skewness Skewness skewness	0.242
Kurtosis Kurtosis kurtosis	-0.355
Angular range angular_range	— – 0.1500 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	54430000.0000
Real-space data points n_real_points	31
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.876; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.988; Smooth: 0.800

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Spike glycoprotein E1
Molecular weight formula_weight	47368.8 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F,J
Atom count atom_count	20314

FEHATTVPNVPGIPYKALVERAGYAPLNLEITVVSSELTPSTNKEYVTCRFHTVIPSPQVKCCGSLECKASSKADYTCRVFGGVYPFMWGGAQCFCDSENTQLSEAYVEFAPDCTIDHAVALKVHTAALKVGLRIVYGNTTAHLDTFVNGVTPGSSRDLKVIAGPISAAFSPFDHKVVIRKGLVYNYDFPEYGAMKPGAFGDIQASSLDATDIVARTDIRLLKPSVKNIHVPYTQAVSGYEMWKNNSGRPLQETAPFGCKIEVEPLRASNCAYGHIPISIDIPDAAFVRSSESPTILEVSCTVADCIYSADFGGSLTLQYKADREGHCPVHSHSTTAVLKEATTHVTAVGSITLHFSTSSPQANFIVSLCGKKTTCNAECKPPADHIIGEPHKVDQEFQAAVSKTSWNWLLALFGGASSLIVVGLIVLVCSSMLINTRR

来源 Source

来源生物 organism	Western equine encephalitis virus
NCBI Class编号 ncbi_taxonomy_id	11039
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Spike glycoprotein E2
Molecular weight formula_weight	46374.8 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G,K

SITDDFTLTSPYLGFCPYCRHSAPCFSPIKIENVWDESDDGSIRIQVSAQFGYNQAGTADVTKFRYMSFDHDHDIKEDSMDKIAISTSGPCRRLGHKGYFLLAQCPPGDSVTVSITSGASENSCTVEKKIRRKFVGREEYLFPPVHGKLVKCHVYDHLKETSAGYITMHRPGPHAYKSYLEEASGEVYIKPPSGKNVTYECKCGDYSTGIVSTRTKMNGCTKAKQCIAYKSDQTKWVFNSPDLIRHTDHSVQGKLHIPFRLTPTVCPVPLAHTPTVTKWFKGITLHLTATRPTLLTTRKLGLRADATAEWITGTTSRNFSVGREGLEYVWGNHEPVRVWAQESAPGDPHGWPHEIIIHYYHRHPVYTVIVLCGVALAILVGTASSAACIAKARRDCLTPYALAPNATVPTALAVLCCI

来源 Source

来源生物 organism	Western equine encephalitis virus
NCBI Class编号 ncbi_taxonomy_id	11039
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	SKW24 Fab heavy chain
Molecular weight formula_weight	25170.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,U

EVQLVESGGGLVQPGGSLRLSCVASGFTFSDYRMAWVRQATGKGLEWVSTISQPSGTNTYYLDPVKGRFTVSRDNAKNTLYLQMHSLRAEDTAVYYCARVVTESRPPAAWFDVWGPGVLVTVSSASTKGPSVFPLAPSSRSTSESTAALGCLVKDYFPEPVTVSWNSGSLTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYVCNVNHKPSNTKVDKRVEIKTCGGLEVLFQ

来源 Source

来源生物 organism	Homo sapiens
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	SKW24 Fab light chain
Molecular weight formula_weight	22888.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,V

SYELTQPPSVSASPGQTARITCGGINIGSELVHWYQQKPPQAPVLVIYANGERPSGIPERFSGSNSGNTATLTISGVEAGDEADYYCQLWDISSDHNYIFGDGTRLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVEVAWKADGSAVNAGVETTKPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAPAECS

来源 Source

来源生物 organism	Homo sapiens
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.20 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	1994280

fit	/app/data/saxs_computation/de/8def/8def.fit
pddf	/app/data/pr_computation/de/8def/8def.pr.out
profile	/app/data/saxs_computation/de/8def/8def.dat

Cryo-EM Structure of Western Equine Encephalitis Virus VLP in complex with SKW24 fab

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spike glycoprotein E1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)