SAXSdb — 8esd

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

COMM domain-containing protein 10

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain T； UniProt 12–202	Not recorded	COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 7 × 1 （Q86VX2）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；2 uM crown ether and 10% glycerol and grown in 22% ethanol and 5 mM EDTA	Resolution 3.33 Å R-free 0.278

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ESD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8F2R Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain J 5–202（198 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain J 1–202（202 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å
8P0W Structure of the human Commander complex COMMD ring Deposited 2023-05-11	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain J 1–202（202 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9ZMY Crystal structure of the human Commd10 HN domain in domain swapped conformation Deposited 2025-12-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 12–127（116 aa） Fragment：HN domain Chain B 12–127（116 aa） Fragment：HN domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；293 K；30% PEG400 in 0.1 M Tris pH 8.0	Resolution 1.62 Å R-free 0.241
9ZN0 Crystal structure of the Commd10 S50E HN domain mutant in domain swapped conformation Deposited 2025-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 12–127（116 aa） Chain C 12–127（116 aa）	Not recorded	LEA PENTANOIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293 K；0.1 M Tris (pH 8.5), 0.1 M Mg formate, and 30% PE14/4, with 10% glycerol used as cryoprotectant	Resolution 2.12 Å R-free 0.243
9ZN0 Crystal structure of the Commd10 S50E HN domain mutant in domain swapped conformation Deposited 2025-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 12–127（116 aa） Chain D 12–127（116 aa）	Not recorded	LEA PENTANOIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293 K；0.1 M Tris (pH 8.5), 0.1 M Mg formate, and 30% PE14/4, with 10% glycerol used as cryoprotectant	Resolution 2.12 Å R-free 0.243

5 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMDA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain T； PDBConstruct 1–191； UniProt 12–202

COMM domain-containing protein 9

Homo sapiens

UniProt Q9P000

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain N； UniProt 5–198	Not recorded	COMM domain-containing protein 10 × 1 （Q9Y6G5） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 7 × 1 （Q86VX2）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；2 uM crown ether and 10% glycerol and grown in 22% ethanol and 5 mM EDTA	Resolution 3.33 Å R-free 0.278

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ESD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4NKN The Crystal Structure of the N-terminal domain of COMMD9 Deposited 2013-11-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116) Chain B 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116) Chain E 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116)	Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291.15 K；20% PEG 3350, 0.2M Mg Nitrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291.15K	Resolution 2.79 Å R-free 0.249
4NKN The Crystal Structure of the N-terminal domain of COMMD9 Deposited 2013-11-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain C 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116) Chain D 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116) Chain F 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116)	Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291.15 K；20% PEG 3350, 0.2M Mg Nitrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291.15K	Resolution 2.79 Å R-free 0.249
4OE9 The crystal structure of the n-terminal domain of COMMD9 Deposited 2014-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa） Fragment：COMMD9, unp residues 1-117	Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF)	CIT CITRIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.9；291.15 K；28% mPEG 5000, 0.2M citric acid, pH 4.9, VAPOR DIFFUSION, HANGING DROP, temperature 291.15K	Resolution 1.55 Å R-free 0.165
4OE9 The crystal structure of the n-terminal domain of COMMD9 Deposited 2014-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–117（117 aa） Fragment：COMMD9, unp residues 1-117	Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF)	CIT CITRIC ACID × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.9；291.15 K；28% mPEG 5000, 0.2M citric acid, pH 4.9, VAPOR DIFFUSION, HANGING DROP, temperature 291.15K	Resolution 1.55 Å R-free 0.165
6BP6 Crystal structure of Commd9 COMM domain Deposited 2017-11-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 115–198（84 aa） Chain B 115–198（84 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；0.1 M HEPES (pH 7.0), 6% Jeffamine M-600	Resolution 2.17 Å R-free 0.285
8F2R Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 1–198（198 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–198（198 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å
8P0W Structure of the human Commander complex COMMD ring Deposited 2023-05-11	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–198（198 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å

6 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD9_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain N； PDBConstruct 1–194； UniProt 5–198

COMM domain-containing protein 5

Homo sapiens

UniProt Q9GZQ3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain F； UniProt 149–222	Not recorded	COMM domain-containing protein 10 × 1 （Q9Y6G5） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 7 × 1 （Q86VX2）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；2 uM crown ether and 10% glycerol and grown in 22% ethanol and 5 mM EDTA	Resolution 3.33 Å R-free 0.278

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ESD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8F2R Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain E 20–224（205 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain E 1–224（224 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å
8P0W Structure of the human Commander complex COMMD ring Deposited 2023-05-11	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain E 1–224（224 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD5_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F； PDBConstruct 1–74； UniProt 149–222

COMM domain-containing protein 7

Homo sapiens

UniProt Q86VX2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain S； UniProt 131–200	Not recorded	COMM domain-containing protein 10 × 1 （Q9Y6G5） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 5 × 1 （Q9GZQ3）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293.15 K；2 uM crown ether and 10% glycerol and grown in 22% ethanol and 5 mM EDTA	Resolution 3.33 Å R-free 0.278

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ESD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8F2R Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–200（200 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain G 1–200（200 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å
8P0W Structure of the human Commander complex COMMD ring Deposited 2023-05-11	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain G 1–200（200 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD7_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain S； PDBConstruct 1–70； UniProt 131–200

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8esd
Deposition date deposition_date	2022-10-13
Structure title title	Crystal structure of COMMD7-COMMD9-COMMD5-COMMD10 tetramer
Keywords keywords	Complex, Commander, Retriever, Commd5, Commd7, Commd9, Commd10, Commd, ENDOCYTOSIS; ENDOCYTOSIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	29.67 Å
Radius of gyration Rg (electron density) rg_electron	28.96 Å
Forward intensity I(0) i0	53511400.00
Molecular weight molecular_weight	58194.0 kDa
Excluded volume excluded_volume	73490 Å³
Envelope volume envelope_volume	98065 Å³
Hydration-shell volume shell_volume	29773 Å³
Envelope diameter envelope_diameter	97.5 Å
Shell Rg shell_rg	34.44 Å
Envelope Rg envelope_rg	29.36 Å
Shape Rg shape_rg	28.93 Å
Total Rg total_rg	29.65 Å
Total atoms total_atoms	4089
Residues n_residues	514
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	100.6 Å
Rg (real space) rg_real	29.79 Å
Rg uncertainty (real space) rg_real_error	1.12 Å
I(0) (real space) i0_real	5.3510e+07
I(0) uncertainty (real space) i0_real_error	9.1090e+05
Rg (reciprocal space) rg_reciprocal	29.74 Å
I(0) (reciprocal space) i0_reciprocal	53510000.0000
Solution quality estimate total_estimate	0.8773
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	34.2 Å
Skewness Skewness skewness	0.454
Kurtosis Kurtosis kurtosis	-0.251
Angular range angular_range	— – 0.2650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	10180000.0000
Real-space data points n_real_points	54
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.836; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.938; Smooth: 0.955

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	COMM domain-containing protein 10
Molecular weight formula_weight	21828.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T
Atom count atom_count	4110

SPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	COMM domain-containing protein 9
Molecular weight formula_weight	21457.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

TAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	COMM domain-containing protein 5
Molecular weight formula_weight	8636.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

LPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLD

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	COMM domain-containing protein 7
Molecular weight formula_weight	8172.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

INQLIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSMECFC

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

▶

8. Citations (1)

▶

Unit-cell length a length_a	215.191 Å
Unit-cell length b length_b	74.895 Å
Unit-cell length c length_c	63.632 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	96.40 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	monoclinic

Resolution resolution	3.330 Å
Low-resolution limit resolution_low	38.500 Å
R factor r_factor	0.2420
R_work r_work	0.2378
R_free r_free	0.2783

fit	/app/data/saxs_computation/es/8esd/8esd.fit
pddf	/app/data/pr_computation/es/8esd/8esd.pr.out
profile	/app/data/saxs_computation/es/8esd/8esd.dat

Crystal structure of COMMD7-COMMD9-COMMD5-COMMD10 tetramer

1. Protein Identity and Related Structures Protein Identity & Related Structures

COMM domain-containing protein 10

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 9

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 5

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 7

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)