8p0w

Structure of the human Commander complex COMMD ring

Method: ELECTRON MICROSCOPY D_max: 134.4 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

COMM domain-containing protein 1

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 1–190	Not recorded	COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2H2M Solution Structure of the N-terminal domain of COMMD1 (Murr1) Deposited 2006-05-19	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–108（108 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.1；298 K；Ionic strength (raw mmCIF value) 50mM NaCl；Pressure ambient NMR sample composition 0.6mM N-COMMD1, U-15N,13C 25mM phosphate buffer, 50mM NaCl, pH 6.1, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 0.95mM N-COMMD1, U-15N,13C 25mM phosphate buffer, 50mM NaCl, pH 6.1, 100% D2O \| 100% D2O	Resolution not provided
8F2R Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain A 1–187（187 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–190（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–190； UniProt 1–190

COMM domain-containing protein 2

OrganismNot specified

UniProt Q86X83

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain B； UniProt 1–199	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8F2R Human CCC complex Deposited 2022-11-08	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain B 1–199（199 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–199（199 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–199； UniProt 1–199

COMM domain-containing protein 3

OrganismNot specified

UniProt Q9UBI1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain C； UniProt 1–195	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8F2R Human CCC complex Deposited 2022-11-08	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 1–195（195 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 1–195（195 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD3_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–195； UniProt 1–195

COMM domain-containing protein 4

OrganismNot specified

UniProt Q9H0A8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain D； UniProt 1–199	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8F2R Human CCC complex Deposited 2022-11-08	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain D 1–199（199 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain D 1–199（199 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å
9ZMZ Crystal structure of the human Commd4 HN domain in a domain swapped conformation Deposited 2025-12-11	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 12–122（111 aa） Fragment：HN domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；293 K；0.1 M Tris (pH 8.0) and 28% PEG4000	Resolution 2.12 Å R-free 0.304

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD4_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–199； UniProt 1–199

COMM domain-containing protein 5

OrganismNot specified

UniProt Q9GZQ3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain E； UniProt 1–224	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8ESD Crystal structure of COMMD7-COMMD9-COMMD5-COMMD10 tetramer Deposited 2022-10-13	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 149–222（74 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；2 uM crown ether and 10% glycerol and grown in 22% ethanol and 5 mM EDTA	Resolution 3.33 Å R-free 0.278
8F2R Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain E 20–224（205 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain E 1–224（224 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD5_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–224； UniProt 1–224

COMM domain-containing protein 6

OrganismNot specified

UniProt Q7Z4G1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain F； UniProt 1–85	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8F2R Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain F 9–85（77 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain F 1–85（85 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD6_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–85； UniProt 1–85

COMM domain-containing protein 7

OrganismNot specified

UniProt Q86VX2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain G； UniProt 1–200	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8ESD Crystal structure of COMMD7-COMMD9-COMMD5-COMMD10 tetramer Deposited 2022-10-13	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain S 131–200（70 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；2 uM crown ether and 10% glycerol and grown in 22% ethanol and 5 mM EDTA	Resolution 3.33 Å R-free 0.278
8F2R Human CCC complex Deposited 2022-11-08	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain G 1–200（200 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain G 1–200（200 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD7_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–200； UniProt 1–200

COMM domain-containing protein 8

OrganismNot specified

UniProt Q9NX08

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain H； UniProt 1–183	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8F2R Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain H 5–183（179 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain H 1–183（183 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD8_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–183； UniProt 1–183

COMM domain-containing protein 9

OrganismNot specified

UniProt Q9P000

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain I； UniProt 1–198	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4NKN The Crystal Structure of the N-terminal domain of COMMD9 Deposited 2013-11-12	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116) Chain B 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116) Chain E 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116)	Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291.15 K；20% PEG 3350, 0.2M Mg Nitrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291.15K	Resolution 2.79 Å R-free 0.249
4NKN The Crystal Structure of the N-terminal domain of COMMD9 Deposited 2013-11-12	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain C 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116) Chain D 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116) Chain F 2–117（116 aa） Fragment：N-terminal domain (UNP residues 1-116)	Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291.15 K；20% PEG 3350, 0.2M Mg Nitrate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291.15K	Resolution 2.79 Å R-free 0.249
4OE9 The crystal structure of the n-terminal domain of COMMD9 Deposited 2014-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–117（117 aa） Fragment：COMMD9, unp residues 1-117	Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF)	CIT CITRIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.9；291.15 K；28% mPEG 5000, 0.2M citric acid, pH 4.9, VAPOR DIFFUSION, HANGING DROP, temperature 291.15K	Resolution 1.55 Å R-free 0.165
4OE9 The crystal structure of the n-terminal domain of COMMD9 Deposited 2014-01-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–117（117 aa） Fragment：COMMD9, unp residues 1-117	Mutation：L67M, I101M Non-standard monomer：Yes (specific site not provided by mmCIF)	CIT CITRIC ACID × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.9；291.15 K；28% mPEG 5000, 0.2M citric acid, pH 4.9, VAPOR DIFFUSION, HANGING DROP, temperature 291.15K	Resolution 1.55 Å R-free 0.165
6BP6 Crystal structure of Commd9 COMM domain Deposited 2017-11-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 115–198（84 aa） Chain B 115–198（84 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；0.1 M HEPES (pH 7.0), 6% Jeffamine M-600	Resolution 2.17 Å R-free 0.285
8ESD Crystal structure of COMMD7-COMMD9-COMMD5-COMMD10 tetramer Deposited 2022-10-13	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain N 5–198（194 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；2 uM crown ether and 10% glycerol and grown in 22% ethanol and 5 mM EDTA	Resolution 3.33 Å R-free 0.278
8F2R Human CCC complex Deposited 2022-11-08	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain I 1–198（198 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain I 1–198（198 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å

6 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMD9_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–198； UniProt 1–198

COMM domain-containing protein 10

OrganismNot specified

UniProt Q9Y6G5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain J； UniProt 1–202	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8ESD Crystal structure of COMMD7-COMMD9-COMMD5-COMMD10 tetramer Deposited 2022-10-13	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain T 12–202（191 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；2 uM crown ether and 10% glycerol and grown in 22% ethanol and 5 mM EDTA	Resolution 3.33 Å R-free 0.278
8F2R Human CCC complex Deposited 2022-11-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain J 5–202（198 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain J 1–202（202 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å
9ZMY Crystal structure of the human Commd10 HN domain in domain swapped conformation Deposited 2025-12-11	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 12–127（116 aa） Fragment：HN domain Chain B 12–127（116 aa） Fragment：HN domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；293 K；30% PEG400 in 0.1 M Tris pH 8.0	Resolution 1.62 Å R-free 0.241
9ZN0 Crystal structure of the Commd10 S50E HN domain mutant in domain swapped conformation Deposited 2025-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 12–127（116 aa） Chain C 12–127（116 aa）	Not recorded	LEA PENTANOIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293 K；0.1 M Tris (pH 8.5), 0.1 M Mg formate, and 30% PE14/4, with 10% glycerol used as cryoprotectant	Resolution 2.12 Å R-free 0.243
9ZN0 Crystal structure of the Commd10 S50E HN domain mutant in domain swapped conformation Deposited 2025-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 12–127（116 aa） Chain D 12–127（116 aa）	Not recorded	LEA PENTANOIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293 K；0.1 M Tris (pH 8.5), 0.1 M Mg formate, and 30% PE14/4, with 10% glycerol used as cryoprotectant	Resolution 2.12 Å R-free 0.243

5 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COMDA_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–202； UniProt 1–202

Coiled-coil domain-containing protein 93

OrganismNot specified

UniProt Q567U6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain K； UniProt 1–631	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 22 × 1 （O60826）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain N 1–631（631 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å
8P0V Structure of the human Commander complex coiled coils, DENND10 and partial Retriever subcomplex Deposited 2023-05-10	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 1–631（631 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.50 Å
8P0X Structure of the human Commander complex Retriever Subcomplex Deposited 2023-05-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 1–631（631 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.50 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CCD93_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–631； UniProt 1–631

Coiled-coil domain-containing protein 22

OrganismNot specified

UniProt O60826

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 12 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain L； UniProt 1–627	Not recorded	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.90 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8P0W	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8F2U Human CCC complex Deposited 2022-11-08	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain T 1–627（627 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；50 mM HEPES pH7.2, 150 mM NaCl, 2mM beta-mercaptoethanol, 0.01% Triton-X100 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å
8P0V Structure of the human Commander complex coiled coils, DENND10 and partial Retriever subcomplex Deposited 2023-05-10	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain L 1–627（627 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.50 Å
8P0X Structure of the human Commander complex Retriever Subcomplex Deposited 2023-05-11	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain L 1–627（627 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.50 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CCD22_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–627； UniProt 1–627

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8p0w
Deposition date deposition_date	2023-05-11
Structure title title	Structure of the human Commander complex COMMD ring
Keywords keywords	COMMD fold, calponin homology fold, pseudo-C5 symmetry, UNKNOWN FUNCTION; UNKNOWN FUNCTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	44.45 Å
Radius of gyration Rg (electron density) rg_electron	43.70 Å
Forward intensity I(0) i0	887694000.00
Molecular weight molecular_weight	248890.0 kDa
Excluded volume excluded_volume	313280 Å³
Envelope volume envelope_volume	464810 Å³
Hydration-shell volume shell_volume	85203 Å³
Envelope diameter envelope_diameter	143.2 Å
Shell Rg shell_rg	52.14 Å
Envelope Rg envelope_rg	42.19 Å
Shape Rg shape_rg	43.69 Å
Total Rg total_rg	44.12 Å
Total atoms total_atoms	17491
Residues n_residues	2208
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	134.4 Å
Rg (real space) rg_real	44.12 Å
Rg uncertainty (real space) rg_real_error	0.85 Å
I(0) (real space) i0_real	8.8770e+08
I(0) uncertainty (real space) i0_real_error	1.4700e+07
Rg (reciprocal space) rg_reciprocal	44.45 Å
I(0) (reciprocal space) i0_reciprocal	888000000.0000
Solution quality estimate total_estimate	0.8944
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	61.4 Å
Skewness Skewness skewness	0.008
Kurtosis Kurtosis kurtosis	-0.563
Angular range angular_range	— – 0.1750 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	86760000.0000
Real-space data points n_real_points	36
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.932; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.964; Smooth: 0.861

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	COMM domain-containing protein 1
Molecular weight formula_weight	21203.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	17512

MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN

Entity 2 Entity 2 polymer

Description description	COMM domain-containing protein 2
Molecular weight formula_weight	22776.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIK

Entity 3 Entity 3 polymer

Description description	COMM domain-containing protein 3
Molecular weight formula_weight	22179.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL

Entity 4 Entity 4 polymer

Description description	COMM domain-containing protein 4
Molecular weight formula_weight	21790.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG

Entity 5 Entity 5 polymer

Description description	COMM domain-containing protein 5
Molecular weight formula_weight	24699.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLQD

Entity 6 Entity 6 polymer

Description description	COMM domain-containing protein 6
Molecular weight formula_weight	9648.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV

Entity 7 Entity 7 polymer

Description description	COMM domain-containing protein 7
Molecular weight formula_weight	22562.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEPKEVERFLAQLSEFATTNQISLGSLRSIVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTLARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSMECFC

Entity 8 Entity 8 polymer

Description description	COMM domain-containing protein 8
Molecular weight formula_weight	21116.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK

Entity 9 Entity 9 polymer

Description description	COMM domain-containing protein 9
Molecular weight formula_weight	21844.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

Entity 10 Entity 10 polymer

Description description	COMM domain-containing protein 10
Molecular weight formula_weight	22995.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT

Entity 11 Entity 11 polymer

Description description	Coiled-coil domain-containing protein 93
Molecular weight formula_weight	73319.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MGLPRGPEGQGLPEVETREDEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYSLPEDDDFIKRKEKAIKTVVDLSEVYKPRRKYKRHQGAEELLDEESRIHATLLEYGRRYGFSRQSKMEKAEDKKTALPAGLSATEKADAHEEDELRAAEEQRIQSLMTKMTAMANEESRLTASSVGQIVGLCSAEIKQIVSEYAEKQSELSAEESPEKLGTSQLHRRKVISLNKQIAQKTKHLEELRASHTSLQARYNEAKKTLTELKTYSEKLDKEQAALEKIESKADPSILQNLRALVAMNENLKSQEQEFKAHCREEMTRLQQEIENLKAERAPRGDEKTLSSGEPPGTLTSAMTHDEDLDRRYNMEKEKLYKIRLLQARRNREIAILHRKIDEVPSRAELIQYQKRFIELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFSQAMASPAARDQFLRQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLEKQRLYFKTVKEFKEEGRKNEMLLSKVKAKAS

Entity 12 Entity 12 polymer

Description description	Coiled-coil domain-containing protein 22
Molecular weight formula_weight	70856.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MEEADRILIHSLRQAGTAVPPDVQTLRAFTTELVVEAVVRCLRVINPAVGSGLSPLLPLAMSARFRLAMSLAQACMDLGYPLELGYQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVASLLEHHALQLCQQTGRDRPGDEDWVHRTSRLPPQEDTRAQRQRLQKQLTEHLRQSWGLLGAPIQARDLGELLQAWGAGAKTGAPKGSRFTHSEKFTFHLEPQAQATQVSDVPATSRRPEQVTWAAQEQELESLREQLEGVNRSIEEVEADMKTLGVSFVQAESECRHSKLSTAEREQALRLKSRAVELLPDGTANLAKLQLVVENSAQRVIHLAGQWEKHRVPLLAEYRHLRKLQDCRELESSRRLAEIQELHQSVRAAAEEARRKEEVYKQLMSELETLPRDVSRLAYTQRILEIVGNIRKQKEEITKILSDTKELQKEINSLSGKLDRTFAVTDELVFKDAKKDDAVRKAYKYLAALHENCSQLIQTIEDTGTIMREVRDLEEQIETELGKKTLSNLEKIREDYRALRQENAGLLGRVREA

Entity 13 Entity 13 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	21

▶

8. Citations (1)

▶

Resolution resolution	2.90 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	667000

fit	/app/data/saxs_computation/p0/8p0w/8p0w.fit
pddf	/app/data/pr_computation/p0/8p0w/8p0w.pr.out
profile	/app/data/saxs_computation/p0/8p0w/8p0w.dat

Structure of the human Commander complex COMMD ring

1. Protein Identity and Related Structures Protein Identity & Related Structures

COMM domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 2

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 3

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 4

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 5

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 6

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 7

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 8

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 9

State in the Current Structure

Other States of the Same Protein in the Database

COMM domain-containing protein 10

State in the Current Structure

Other States of the Same Protein in the Database

Coiled-coil domain-containing protein 93

State in the Current Structure

Other States of the Same Protein in the Database

Coiled-coil domain-containing protein 22

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)