8p0w

Structure of the human Commander complex COMMD ring

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

COMM domain-containing protein 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMD1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–190； UniProt 1–190

COMM domain-containing protein 2

OrganismNot specified

UniProt Q86X83

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMD2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–199； UniProt 1–199

COMM domain-containing protein 3

OrganismNot specified

UniProt Q9UBI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMD3_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–195； UniProt 1–195

COMM domain-containing protein 4

OrganismNot specified

UniProt Q9H0A8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMD4_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–199； UniProt 1–199

COMM domain-containing protein 5

OrganismNot specified

UniProt Q9GZQ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMD5_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–224； UniProt 1–224

COMM domain-containing protein 6

OrganismNot specified

UniProt Q7Z4G1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMD6_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–85； UniProt 1–85

COMM domain-containing protein 7

OrganismNot specified

UniProt Q86VX2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMD7_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–200； UniProt 1–200

COMM domain-containing protein 8

OrganismNot specified

UniProt Q9NX08

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMD8_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–183； UniProt 1–183

COMM domain-containing protein 9

OrganismNot specified

UniProt Q9P000

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMD9_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–198； UniProt 1–198

COMM domain-containing protein 10

OrganismNot specified

UniProt Q9Y6G5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） Coiled-coil domain-containing protein 93 × 1 （Q567U6） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COMDA_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–202； UniProt 1–202

Coiled-coil domain-containing protein 93

OrganismNot specified

UniProt Q567U6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 22 × 1 （O60826） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CCD93_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–631； UniProt 1–631

Coiled-coil domain-containing protein 22

OrganismNot specified

UniProt O60826

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	COMM domain-containing protein 1 × 1 （Q8N668） COMM domain-containing protein 2 × 1 （Q86X83） COMM domain-containing protein 3 × 1 （Q9UBI1） COMM domain-containing protein 4 × 1 （Q9H0A8） COMM domain-containing protein 5 × 1 （Q9GZQ3） COMM domain-containing protein 6 × 1 （Q7Z4G1） COMM domain-containing protein 7 × 1 （Q86VX2） COMM domain-containing protein 8 × 1 （Q9NX08） COMM domain-containing protein 9 × 1 （Q9P000） COMM domain-containing protein 10 × 1 （Q9Y6G5） Coiled-coil domain-containing protein 93 × 1 （Q567U6） water × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CCD22_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–627； UniProt 1–627

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8p0w
Deposition date deposition_date	2023-05-11
Structure title title	Structure of the human Commander complex COMMD ring
Keywords keywords	COMMD fold, calponin homology fold, pseudo-C5 symmetry, UNKNOWN FUNCTION; UNKNOWN FUNCTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8p0w__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8p0w__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8p0w__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.45 Å
Rg (electron density)	43.70 Å
Total Rg	44.12 Å
Atom count	17491
Residues	2208
Excluded volume	313280 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8p0w__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	COMM domain-containing protein 1
Molecular weight formula_weight	21203.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	17512

MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN

Entity 2 Entity 2 polymer

Description description	COMM domain-containing protein 2
Molecular weight formula_weight	22776.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIK

Entity 3 Entity 3 polymer

Description description	COMM domain-containing protein 3
Molecular weight formula_weight	22179.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL

Entity 4 Entity 4 polymer

Description description	COMM domain-containing protein 4
Molecular weight formula_weight	21790.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG

Entity 5 Entity 5 polymer

Description description	COMM domain-containing protein 5
Molecular weight formula_weight	24699.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLQD

Entity 6 Entity 6 polymer

Description description	COMM domain-containing protein 6
Molecular weight formula_weight	9648.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV

Entity 7 Entity 7 polymer

Description description	COMM domain-containing protein 7
Molecular weight formula_weight	22562.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEPKEVERFLAQLSEFATTNQISLGSLRSIVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTLARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSMECFC

Entity 8 Entity 8 polymer

Description description	COMM domain-containing protein 8
Molecular weight formula_weight	21116.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK

Entity 9 Entity 9 polymer

Description description	COMM domain-containing protein 9
Molecular weight formula_weight	21844.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK

Entity 10 Entity 10 polymer

Description description	COMM domain-containing protein 10
Molecular weight formula_weight	22995.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT

Entity 11 Entity 11 polymer

Description description	Coiled-coil domain-containing protein 93
Molecular weight formula_weight	73319.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MGLPRGPEGQGLPEVETREDEEQNVKLTEILELLVAAGYFRARIKGLSPFDKVVGGMTWCITTCNFDVDVDLLFQENSTIGQKIALSEKIVSVLPRMKCPHQLEPHQIQGMDFIHIFPVVQWLVKRAIETKEEMGDYIRSYSVSQFQKTYSLPEDDDFIKRKEKAIKTVVDLSEVYKPRRKYKRHQGAEELLDEESRIHATLLEYGRRYGFSRQSKMEKAEDKKTALPAGLSATEKADAHEEDELRAAEEQRIQSLMTKMTAMANEESRLTASSVGQIVGLCSAEIKQIVSEYAEKQSELSAEESPEKLGTSQLHRRKVISLNKQIAQKTKHLEELRASHTSLQARYNEAKKTLTELKTYSEKLDKEQAALEKIESKADPSILQNLRALVAMNENLKSQEQEFKAHCREEMTRLQQEIENLKAERAPRGDEKTLSSGEPPGTLTSAMTHDEDLDRRYNMEKEKLYKIRLLQARRNREIAILHRKIDEVPSRAELIQYQKRFIELYRQISAVHKETKQFFTLYNTLDDKKVYLEKEISLLNSIHENFSQAMASPAARDQFLRQMEQIVEGIKQSRMKMEKKKQENKMRRDQLNDQYLELLEKQRLYFKTVKEFKEEGRKNEMLLSKVKAKAS

Entity 12 Entity 12 polymer

Description description	Coiled-coil domain-containing protein 22
Molecular weight formula_weight	70856.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MEEADRILIHSLRQAGTAVPPDVQTLRAFTTELVVEAVVRCLRVINPAVGSGLSPLLPLAMSARFRLAMSLAQACMDLGYPLELGYQNFLYPSEPDLRDLLLFLAERLPTDASEDADQPAGDSAILLRAIGSQIRDQLALPWVPPHLRTPKLQHLQGSALQKPFHASRLVVPELSSRGEPREFQASPLLLPVPTQVPQPVGRVASLLEHHALQLCQQTGRDRPGDEDWVHRTSRLPPQEDTRAQRQRLQKQLTEHLRQSWGLLGAPIQARDLGELLQAWGAGAKTGAPKGSRFTHSEKFTFHLEPQAQATQVSDVPATSRRPEQVTWAAQEQELESLREQLEGVNRSIEEVEADMKTLGVSFVQAESECRHSKLSTAEREQALRLKSRAVELLPDGTANLAKLQLVVENSAQRVIHLAGQWEKHRVPLLAEYRHLRKLQDCRELESSRRLAEIQELHQSVRAAAEEARRKEEVYKQLMSELETLPRDVSRLAYTQRILEIVGNIRKQKEEITKILSDTKELQKEINSLSGKLDRTFAVTDELVFKDAKKDDAVRKAYKYLAALHENCSQLIQTIEDTGTIMREVRDLEEQIETELGKKTLSNLEKIREDYRALRQENAGLLGRVREA

Entity 13 Entity 13 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	21

▶

Resolution resolution	2.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	667000

Structure of the human Commander complex COMMD ring

1. Protein Identity and Related Structures Protein Identity & Related Structures

COMM domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COMM domain-containing protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COMM domain-containing protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COMM domain-containing protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COMM domain-containing protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COMM domain-containing protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COMM domain-containing protein 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COMM domain-containing protein 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COMM domain-containing protein 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COMM domain-containing protein 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer