SAXSdb — 8ilb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribulose bisphosphate carboxylase large chain

Synechococcus elongatus PCC 6301

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Rubisco accumulation factor 1.2, chloroplastic × 2 （Q9SR19） Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic × 8 （Q9SN73）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RBL_SYNP6
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–472； UniProt 1–472 Author chain B； PDBConstruct 1–472； UniProt 1–472 Author chain C； PDBConstruct 1–472； UniProt 1–472 Author chain D； PDBConstruct 1–472； UniProt 1–472 Author chain J； PDBConstruct 1–472； UniProt 1–472 Author chain K； PDBConstruct 1–472； UniProt 1–472 Author chain L； PDBConstruct 1–472； UniProt 1–472 Author chain M； PDBConstruct 1–472； UniProt 1–472

Rubisco accumulation factor 1.2, chloroplastic

Arabidopsis thaliana

UniProt Q9SR19

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Ribulose bisphosphate carboxylase large chain × 8 （P00880） Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic × 8 （Q9SN73）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RAF2_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 2–389； UniProt 62–449 Author chain N； PDBConstruct 2–389； UniProt 62–449

Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic

Arabidopsis thaliana

UniProt Q9SN73

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Ribulose bisphosphate carboxylase large chain × 8 （P00880） Rubisco accumulation factor 1.2, chloroplastic × 2 （Q9SR19）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BSD2_ARATH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F； PDBConstruct 2–81； UniProt 57–136 Author chain G； PDBConstruct 2–81； UniProt 57–136 Author chain H； PDBConstruct 2–81； UniProt 57–136 Author chain I； PDBConstruct 2–81； UniProt 57–136 Author chain O； PDBConstruct 2–81； UniProt 57–136 Author chain P； PDBConstruct 2–81； UniProt 57–136 Author chain Q； PDBConstruct 2–81； UniProt 57–136 Author chain R； PDBConstruct 2–81； UniProt 57–136

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ilb
Deposition date deposition_date	2023-03-03
Structure title title	The complexes of RbcL, AtRaf1 and AtBSD2 (LFB)
Keywords keywords	RUBISCO ASSEMBL INTERMIDATES, COMPLEX, CHAPERONE, LYASE-CHAPERONE complex; LYASE/CHAPERONE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ilb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ilb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ilb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.32 Å
Rg (electron density)	50.50 Å
Total Rg	50.77 Å
Atom count	36322
Residues	4680
Excluded volume	642490 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ilb__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Ribulose bisphosphate carboxylase large chain
Molecular weight formula_weight	52516.6 kDa
EC 编号 ec_number	4.1.1.39
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,J,K,L,M
Atom count atom_count	36322

MPKTQSAAGYKAGVKDYKLTYYTPDYTPKDTDLLAAFRFSPQPGVPADEAGAAIAAESSTGTWTTVWTDLLTDMDRYKGKCYHIEPVQGEENSYFAFIAYPLDLFEEGSVTNILTSIVGNVFGFKAIRSLRLEDIRFPVALVKTFQGPPHGIQVERDLLNKYGRPMLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKSQAETGEIKGHYLNVTAPTCEEMMKRAEFAKELGMPIIMHDFLTAGFTANTTLAKWCRDNGVLLHIHRAMHAVIDRQRNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGDKASTLGFVDLMREDHIEADRSRGVFFTQDWASMPGVLPVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATANRVALEACVQARNEGRDLYREGGDILREAGKWSPELAAALDLWKEIKFEFETMDKL

Source Source

Source organism organism	Synechococcus elongatus PCC 6301
NCBI taxonomy ID ncbi_taxonomy_id	269084
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Rubisco accumulation factor 1.2, chloroplastic
Molecular weight formula_weight	43732.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,N

MQQLYQPFRPPSSPIPTQFRSLDSAGKIEILAGRMALWFEYAPLISSLYTDGFTPPTIEELTGISSIEQNRLIVGAQVRDSILQSIHEPELISAFDTGGAELLYEIRLLSTTQRVAAATFIIDRNIDSKGAQDLARAIKDYPNRRGDVGWLDFDYNLPGDCLSFLYYRQSRENKNPSDQRTSMLLQALGVAESEKAKNRLNTELYGDKEAEKEKEKKKKEEEVKAIRIPVVRLKFGEVAEATSVVVLPVCKAEEGEKKILEAPMEIIAGGDFKVVEAEKGWKRWVVLPSWNPVAAIGKGGVAVSFRDDRKVLPWDGKEEPLLVVADRVRNVVEADDGYYLVVAENGLKLEKGSDLKAREVKESLGMVVLVVRPPREDDDDWQTSHQNWD

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic
Molecular weight formula_weight	8355.5 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G,H,I,O,P,Q,R

MAANNNPQGTKPNSLVCANCEGEGCVACSQCKGGGVNLIDHFNGQFKAGALCWLCRGKKEVLCGDCNGAGFIGGFLSTFDE

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	233489

The complexes of RbcL, AtRaf1 and AtBSD2 (LFB)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribulose bisphosphate carboxylase large chain

State in the Current Structure

Other States of the Same Protein in the Database

Rubisco accumulation factor 1.2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ilb__assembly_1__model_1

8ilb__assembly_1__model_1 | I(q)

8ilb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

The complexes of RbcL, AtRaf1 and AtBSD2 (LFB)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribulose bisphosphate carboxylase large chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Rubisco accumulation factor 1.2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Protein BUNDLE SHEATH DEFECTIVE 2, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ilb__assembly_1__model_1

8ilb__assembly_1__model_1 | I(q)

8ilb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)