8ixd

GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin non-seam region

Method: ELECTRON MICROSCOPY D_max: 232.3 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin alpha-1C chain

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain A； UniProt 1–449 Chain B； UniProt 1–449 Chain C； UniProt 1–449 Chain D； UniProt 1–449 Chain E； UniProt 1–449 Chain F； UniProt 1–449 Chain G； UniProt 1–449 Chain H； UniProt 1–449 Chain I； UniProt 1–449	Not recorded	Tubulin beta-2A chain × 9 （Q7TMM9） Kinesin-1 heavy chain × 9 （P33176） GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 6.9 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.40 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8IXD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
12DL Native structure of the cytoplasmic lattice (CPL) asymmetric unit from mouse MII eggs Deposited 2026-03-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 33 PDB declaration: 33-meric	Chain EA 1–449（449 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 2 ZN ZINC ION × 11 CA CALCIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
24MC Structure of oocyte cytoplasmic lattices Deposited 2026-03-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain X 1–449（449 aa） Chain Y 1–449（449 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 5 GTP GUANOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 4 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8IXE GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–449（449 aa） Chain H 1–449（449 aa） Chain J 1–449（449 aa） Chain K 1–449（449 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TBA1C_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–455； UniProt 1–449 Author chain B； PDBConstruct 1–455； UniProt 1–449 Author chain C； PDBConstruct 1–455； UniProt 1–449 Author chain D； PDBConstruct 1–455； UniProt 1–449 Author chain E； PDBConstruct 1–455； UniProt 1–449 Author chain F； PDBConstruct 1–455； UniProt 1–449 Author chain G； PDBConstruct 1–455； UniProt 1–449 Author chain H； PDBConstruct 1–455； UniProt 1–449 Author chain I； PDBConstruct 1–455； UniProt 1–449

Tubulin beta-2A chain

Mus musculus

UniProt Q7TMM9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain J； UniProt 1–445 Chain K； UniProt 1–445 Chain L； UniProt 1–445 Chain M； UniProt 1–445 Chain N； UniProt 1–445 Chain O； UniProt 1–445 Chain P； UniProt 1–445 Chain Q； UniProt 1–445 Chain R； UniProt 1–445	Not recorded	Tubulin alpha-1C chain × 9 （P68373） Kinesin-1 heavy chain × 9 （P33176） GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 6.9 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8IXD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
24MC Structure of oocyte cytoplasmic lattices Deposited 2026-03-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain W 1–445（445 aa） Chain Z 1–445（445 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 5 GTP GUANOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 4 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8IXA GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin non-seam region Deposited 2023-03-31	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain J 1–445（445 aa） Chain K 1–445（445 aa） Chain L 1–445（445 aa） Chain M 1–445（445 aa） Chain N 1–445（445 aa） Chain O 1–445（445 aa） Chain P 1–445（445 aa） Chain Q 1–445（445 aa） Chain R 1–445（445 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8IXB GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain Q 1–445（445 aa） Chain U 1–445（445 aa） Chain V 1–445（445 aa） Chain W 1–445（445 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8IXE GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain R 1–445（445 aa） Chain W 1–445（445 aa） Chain Z 1–445（445 aa） Chain a 1–445（445 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8IXF GMPCPP-Alpha4A/Beta2A-microtubule decorated with kinesin non-seam region Deposited 2023-03-31	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain J 1–445（445 aa） Chain K 1–445（445 aa） Chain L 1–445（445 aa） Chain M 1–445（445 aa） Chain N 1–445（445 aa） Chain O 1–445（445 aa） Chain P 1–445（445 aa） Chain Q 1–445（445 aa） Chain R 1–445（445 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8IXG GMPCPP-Alpha4A/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain R 1–445（445 aa） Chain W 1–445（445 aa） Chain Z 1–445（445 aa） Chain a 1–445（445 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
9W2M Cryo-EM structure of the Cytoplasmic lattice(CPL) from mouse oocyte Deposited 2025-07-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain L 1–445（445 aa） Chain l 1–445（445 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TBB2A_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 1–445； UniProt 1–445 Author chain K； PDBConstruct 1–445； UniProt 1–445 Author chain L； PDBConstruct 1–445； UniProt 1–445 Author chain M； PDBConstruct 1–445； UniProt 1–445 Author chain N； PDBConstruct 1–445； UniProt 1–445 Author chain O； PDBConstruct 1–445； UniProt 1–445 Author chain P； PDBConstruct 1–445； UniProt 1–445 Author chain Q； PDBConstruct 1–445； UniProt 1–445 Author chain R； PDBConstruct 1–445； UniProt 1–445

Kinesin-1 heavy chain

Homo sapiens

UniProt P33176

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain S； UniProt 1–349 Chain T； UniProt 1–349 Chain U； UniProt 1–349 Chain V； UniProt 1–349 Chain W； UniProt 1–349 Chain X； UniProt 1–349 Chain Y； UniProt 1–349 Chain Z； UniProt 1–349 Chain a； UniProt 1–349	Not recorded	Tubulin alpha-1C chain × 9 （P68373） Tubulin beta-2A chain × 9 （Q7TMM9） GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 6.9 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.40 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8IXD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1BG2 HUMAN UBIQUITOUS KINESIN MOTOR DOMAIN Deposited 1998-06-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–325（325 aa） Fragment：MOTOR DOMAIN	Not recorded	MG MAGNESIUM ION × 1 ACT ACETATE ION × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；5 MG/ML PROTEIN, 50 MM NA ACETATE PH 4.6, 75 MM KCL, 3.5% PEG 4K, 2.5 MM ATP, 10 MM MGCL2	Resolution 1.80 Å R-free 0.288
1MKJ Human Kinesin Motor Domain With Docked Neck Linker Deposited 2002-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa） Fragment：Residues 1-349	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；277 K；1.5-2 M Li2SO4, 25 mM HEPES pH 7.5, 0-50 mM KCl, pH 7.50, temperature 277K	Resolution 2.70 Å R-free 0.255
3J8X High-resolution structure of no-nucleotide kinesin on microtubules Deposited 2014-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 1–349（349 aa） Fragment：Truncated catalytic head domain (monomeric, UNP residues 1-349)	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 25 mM PIPES, 25 mM NaCl, 2 mM MgCl2, 1 mM EGTA；pH 6.8；25 mM PIPES, 25 mM NaCl, 2 mM MgCl2, 1 mM EGTA cryo-EM vitrification conditions No glow discharge was applied. After sample application to grid, liquid was mostly 'wicked' away by edgewise application of filter paper. Subsequently, blotting and plunge freezing were performed with ~0.5 second delay after blotting but prior to plunging.；Cryogen ETHANE；No glow discharge was applied. After sample application to grid, liquid was mostly 'wicked' away by edgewise application of filter paper. Subsequently, blotting and plunge freezing were performed with ~0.5 second delay after blotting but prior to plunging into liquid ethane.	Resolution 5.00 Å
3J8Y High-resolution structure of ATP analog-bound kinesin on microtubules Deposited 2014-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 1–349（349 aa） Fragment：Truncated catalytic head domain (monomeric, UNP residues 1-349)	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 25 mM PIPES, 25 mM NaCl, 2 mM MgCl2, 1 mM EGTA；pH 6.8；25 mM PIPES, 25 mM NaCl, 2 mM MgCl2, 1 mM EGTA cryo-EM vitrification conditions No glow discharge was applied. After sample application to grid, liquid was mostly 'wicked' away by edgewise application of filter paper. Subsequently, blotting and plunge freezing were performed with ~0.5 second delay after blotting but prior to plunging.；Cryogen ETHANE；No glow discharge was applied. After sample application to grid, liquid was mostly 'wicked' away by edgewise application of filter paper. Subsequently, blotting and plunge freezing were performed with ~0.5 second delay after blotting but prior to plunging into liquid ethane.	Resolution 5.00 Å
4HNA Kinesin motor domain in the ADP-MG-ALFX state in complex with tubulin and a DARPIN Deposited 2012-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain K 1–349（349 aa） Fragment：RESIDUES 1-349	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 3 GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；293 K；PEG, PIPES BUFFER, PH 6.8, 0.8 MM ALCL3, 4 MM NAF, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.19 Å R-free 0.211
4LNU Nucleotide-free kinesin motor domain in complex with tubulin and a DARPin Deposited 2013-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain K 1–325（325 aa） Fragment：UNP RESIDUES 1-325	Mutation：C7S, C65A, C168A, C174S, C294A	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 11 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG, MES BUFFER, 0.2M AMMONIUM SULFATE, pH 6.50, VAPOR DIFFUSION, temperature 293K	Resolution 2.19 Å R-free 0.195
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain K 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain K 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
6OJQ Monomeric kinesin-1 motor domain in no-nucleotide state bound to GMPCPP-stabilized microtubule Deposited 2019-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 8–324（317 aa）	Not recorded	G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MG MAGNESIUM ION × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å
7RIK Magic-Angle-Spinning NMR Structure of Kinesin-1 Motor Domain Assembled with Microtubules Deposited 2021-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa） Fragment：Kinesin motor domain residues 1-349	Not recorded	No recorded non-water small molecule	SOLID-STATE NMR NMR measurement conditions pH 7.4；283 K；Ionic strength (raw mmCIF value) 100；Pressure 1 NMR sample composition 9.1 % w/w [U-100% 13C; U-100% 15N] Apo-Kif5b, 16.4 % w/w Porcine-alpha-tubulin, 16.4 % w/w Porcine-beta-tubulin, 5 uM TAXOL, 1 mM GUANOSINE-5'-TRIPHOSPHATE, 1 mM GUANOSINE-5'-DIPHOSPHATE, 58.1 % w/w Buffer, 100% H2O \| 100% H2O NMR sample composition 9.1 % w/w [U-100% 13C; U-100% 15N] Apo-Kif5b, 16.4 % w/w Porcine-alpha-tubulin, 16.4 % w/w Porcine-beta-tubulin, 5 uM TAXOL, 1 mM GUANOSINE-5'-TRIPHOSPHATE, 1 mM GUANOSINE-5'-DIPHOSPHATE, 58.1 % w/w Buffer, 100% H2O \| 100% H2O NMR sample composition 8.2 % w/w [1,6-13C-glucose; U-100% 15N] Apo-Kif5b, 16.4 % w/w Porcine-alpha-tubulin, 16.4 % w/w Porcine-beta-tubulin, 5 uM TAXOL, 1 mM GUANOSINE-5'-TRIPHOSPHATE, 1 mM GUANOSINE-5'-DIPHOSPHATE, 59 % w/w Buffer, 100% H2O \| 100% H2O NMR sample composition 7.6 % w/w [2-13C-glucose; U-100% 15N] Apo-Kif5b, 16.4 % w/w Porcine-alpha-tubulin, 16.4 % w/w Porcine-beta-tubulin, 5 uM TAXOL, 1 mM GUANOSINE-5'-TRIPHOSPHATE, 1 mM GUANOSINE-5'-DIPHOSPHATE, 59.6 % w/w Buffer, 100% H2O \| 100% H2O	Resolution not provided
7TR1 CaKip3[2-436]-L2-mutant(HsKHC) - AMP-PNP in complex with a microtubule Deposited 2022-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 41–44（4 aa）	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7TR2 Apo CaKip3[2-436]-L2-mutant(HsKHC) in complex with a microtubule Deposited 2022-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 41–44（4 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8IXA GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin non-seam region Deposited 2023-03-31	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain S 1–349（349 aa） Chain T 1–349（349 aa） Chain U 1–349（349 aa） Chain V 1–349（349 aa） Chain W 1–349（349 aa） Chain X 1–349（349 aa） Chain Y 1–349（349 aa） Chain Z 1–349（349 aa） Chain a 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8IXB GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain g 1–349（349 aa） Chain k 1–349（349 aa） Chain l 1–349（349 aa） Chain m 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8IXE GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain h 1–349（349 aa） Chain l 1–349（349 aa） Chain p 1–349（349 aa） Chain q 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8IXF GMPCPP-Alpha4A/Beta2A-microtubule decorated with kinesin non-seam region Deposited 2023-03-31	Parsed fields agree	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain S 1–349（349 aa） Chain T 1–349（349 aa） Chain U 1–349（349 aa） Chain V 1–349（349 aa） Chain W 1–349（349 aa） Chain X 1–349（349 aa） Chain Y 1–349（349 aa） Chain Z 1–349（349 aa） Chain a 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8IXG GMPCPP-Alpha4A/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain h 1–349（349 aa） Chain l 1–349（349 aa） Chain p 1–349（349 aa） Chain q 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8RHB Microtubule-associated kinesin-1 tail complex bound to AMPPNP, single-headed state Deposited 2023-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 1–963（963 aa） Chain T 1–963（963 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8；BRB80 + 5mM AMPPNP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8RHH Microtubule-associated kinesin-1 tail complex bound to AMPPNP, two-headed state Deposited 2023-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: pentameric	Chain K 1–963（963 aa） Chain L 1–963（963 aa） Chain T 1–963（963 aa） Chain t 1–963（963 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8；BRB80 + 5mM AMPPNP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8RIK Microtubule-associated kinesin-1 tail complex bound to ADP, single-headed state Deposited 2023-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: tetrameric	Chain K 1–963（963 aa） Chain T 1–963（963 aa） Chain t 1–963（963 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8；BRB80 + 5 mM ADP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8RIZ Microtubule-associated kinesin-1 tail complex bound to ADP, two-headed state Deposited 2023-12-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 1–963（963 aa） Chain L 1–963（963 aa） Chain T 1–963（963 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8；BRB80 + 5mM ADP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9GNQ Microtubule-associated Kif5B IAK tail mutant bound to ADP Deposited 2024-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 1–357（357 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8；BRB80 + 5mM AMPPNP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9L6K Crystal structure of nucleotide-free human kinesin-1 motor domain (G234V mutant) Deposited 2024-12-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–336（335 aa）	Mutation：G234V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；277 K；20% PEG 3350, 100mM HEPES-NaOH, 200mM ammonium acetate, 3% xylitol	Resolution 2.80 Å R-free 0.258
9L6K Crystal structure of nucleotide-free human kinesin-1 motor domain (G234V mutant) Deposited 2024-12-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–336（335 aa）	Mutation：G234V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；277 K；20% PEG 3350, 100mM HEPES-NaOH, 200mM ammonium acetate, 3% xylitol	Resolution 2.80 Å R-free 0.258
9L78 Crystal structure of nucleotide-free human kinesin-1 motor domain (G234A mutant) Deposited 2024-12-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–336（335 aa）	Mutation：G234A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；20 % PEG 3350, 100mM HEPES-NaOH, 200mM ammonium acetate, 3% xylitol, pH 7.9	Resolution 2.82 Å R-free 0.265
9L78 Crystal structure of nucleotide-free human kinesin-1 motor domain (G234A mutant) Deposited 2024-12-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–336（335 aa）	Mutation：G234A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；20 % PEG 3350, 100mM HEPES-NaOH, 200mM ammonium acetate, 3% xylitol, pH 7.9	Resolution 2.82 Å R-free 0.265
9L7E Crystal structure of human kinesin-1 motor domain (G234A mutant) in complex with ADP Deposited 2024-12-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa）	Mutation：G234A	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；23% PEG 3350, 100mM Bis-Tris, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.252
9L7M Nucleotide-free kinesin-1 motor domain bound to the microtubule Deposited 2024-12-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.48 Å

26 other PDB entries and 38 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KINH_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain S； PDBConstruct 24–372； UniProt 1–349 Author chain T； PDBConstruct 24–372； UniProt 1–349 Author chain U； PDBConstruct 24–372； UniProt 1–349 Author chain V； PDBConstruct 24–372； UniProt 1–349 Author chain W； PDBConstruct 24–372； UniProt 1–349 Author chain X； PDBConstruct 24–372； UniProt 1–349 Author chain Y； PDBConstruct 24–372； UniProt 1–349 Author chain Z； PDBConstruct 24–372； UniProt 1–349 Author chain a； PDBConstruct 24–372； UniProt 1–349

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ixd
Deposition date deposition_date	2023-03-31
Structure title title	GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin non-seam region
Keywords keywords	microtubule, tubulin isotype, cryo-EM structure, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	87.69 Å
Radius of gyration Rg (electron density) rg_electron	87.97 Å
Forward intensity I(0) i0	21080000000.00
Molecular weight molecular_weight	1199500.0 kDa
Excluded volume excluded_volume	1484600 Å³
Envelope volume envelope_volume	2249800 Å³
Hydration-shell volume shell_volume	214310 Å³
Envelope diameter envelope_diameter	318.2 Å
Shell Rg shell_rg	80.55 Å
Envelope Rg envelope_rg	85.85 Å
Shape Rg shape_rg	87.97 Å
Total Rg total_rg	87.91 Å
Total atoms total_atoms	84096
Residues n_residues	10602
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	232.3 Å
Rg (real space) rg_real	84.16 Å
Rg uncertainty (real space) rg_real_error	0.62 Å
I(0) (real space) i0_real	2.0140e+10
I(0) uncertainty (real space) i0_real_error	4.1810e+08
Rg (reciprocal space) rg_reciprocal	86.38 Å
I(0) (reciprocal space) i0_reciprocal	20990000000.0000
Solution quality estimate total_estimate	0.9117
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	90.3 Å
Skewness Skewness skewness	0.259
Kurtosis Kurtosis kurtosis	-0.639
Angular range angular_range	— – 0.0900 Å⁻¹
Current regularization parameter α current_alpha	1.0130
Highest regularization parameter α highest_alpha	750900000.0000
Real-space data points n_real_points	19
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 1.000; Stabil: 0.966; Sysdev: 1.000; Positv: 1.000; Valcen: 0.956; Smooth: 0.002

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Tubulin alpha-1C chain
Molecular weight formula_weight	50791.0 kDa
EC 编号 ec_number	3.6.5.-
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,A,B,C,D,E,F,G,H
Atom count atom_count	84096

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIHHHHHHGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSAEGDDEGEEY

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Insecta environmental sample

Entity 2 Entity 2 polymer

Description description	Tubulin beta-2A chain
Molecular weight formula_weight	51151.0 kDa
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,J,K,L,M,N,O,P,R

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEAGGSGGDYKDDDK

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Insecta environmental sample

Entity 3 Entity 3 polymer

Description description	Kinesin-1 heavy chain
Molecular weight formula_weight	41721.1 kDa
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,S,T,U,V,W,X,Z,a

MGSSHHHHHHSSGLVPRGSHMASMADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSAKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKE

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 5 Entity 5 non-polymer

Description description	PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER
Molecular weight formula_weight	521.2 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 6 Entity 6 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	9

▶

8. Citations (1)

▶

Resolution resolution	4.40 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	21250

fit	/app/data/saxs_computation/ix/8ixd/8ixd.fit
pddf	/app/data/pr_computation/ix/8ixd/8ixd.pr.out
profile	/app/data/saxs_computation/ix/8ixd/8ixd.dat

GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin non-seam region

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin alpha-1C chain

State in the Current Structure

Other States of the Same Protein in the Database

Tubulin beta-2A chain

State in the Current Structure

Other States of the Same Protein in the Database

Kinesin-1 heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)