12dl

Native structure of the cytoplasmic lattice (CPL) asymmetric unit from mouse MII eggs

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin beta-4B chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB4B_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain FA； PDBConstruct 1–445； UniProt 1–445

NACHT, LRR and PYD domains-containing protein 5

OrganismNot specified

UniProt Q9R1M5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NALP5_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain GA； PDBConstruct 1–1163； UniProt 1–1163 Author chain GB； PDBConstruct 1–1163； UniProt 1–1163

Oocyte-expressed protein homolog

OrganismNot specified

UniProt Q9CWE6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OOEP_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain IA； PDBConstruct 1–164； UniProt 1–164 Author chain JA； PDBConstruct 1–164； UniProt 1–164

Transducin-like enhancer protein 6

OrganismNot specified

UniProt Q9WVB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TLE6_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain HA； PDBConstruct 1–581； UniProt 1–581 Author chain HB； PDBConstruct 1–581； UniProt 1–581

Zinc finger BED domain-containing protein 3

OrganismNot specified

UniProt Q9D0L1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ZBED3_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain KA； PDBConstruct 1–227； UniProt 2–228

KH domain-containing protein 3

OrganismNot specified

UniProt Q9CWU5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KHDC3_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain LA； PDBConstruct 1–440； UniProt 1–440

NLR family, pyrin domain containing 4F

OrganismNot specified

UniProt L7N1W9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L7N1W9_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain MA； PDBConstruct 1–937； UniProt 1–937

Inactive protein-arginine deiminase type-6

OrganismNot specified

UniProt Q8K3V4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PADI6_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AA； PDBConstruct 1–682； UniProt 1–682 Author chain AB； PDBConstruct 1–682； UniProt 1–682 Author chain AC； PDBConstruct 1–682； UniProt 1–682 Author chain AD； PDBConstruct 1–682； UniProt 1–682 Author chain AE； PDBConstruct 1–682； UniProt 1–682 Author chain AF； PDBConstruct 1–682； UniProt 1–682 Author chain AG； PDBConstruct 1–682； UniProt 1–682 Author chain AH； PDBConstruct 1–682； UniProt 1–682 Author chain AI； PDBConstruct 1–682； UniProt 1–682 Author chain AJ； PDBConstruct 1–682； UniProt 1–682

Tubulin alpha-1C chain

OrganismNot specified

UniProt P68373

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1C_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain EA； PDBConstruct 1–449； UniProt 1–449

NACHT, LRR and PYD domains-containing protein 14

OrganismNot specified

UniProt Q6B966

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NAL14_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain DA； PDBConstruct 1–993； UniProt 1–993 Author chain DB； PDBConstruct 1–993； UniProt 1–993

E3 ubiquitin-protein ligase UHRF1

OrganismNot specified

UniProt Q8VDF2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UHRF1_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain BA； PDBConstruct 1–782； UniProt 1–782 Author chain BB； PDBConstruct 1–782； UniProt 1–782

Ubiquitin-conjugating enzyme E2 D3

OrganismNot specified

UniProt P61079

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UB2D3_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain CA； PDBConstruct 1–147； UniProt 1–147 Author chain CB； PDBConstruct 1–147； UniProt 1–147

F-box and WD-40 domain protein 19

OrganismNot specified

UniProt Q8C2W8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8C2W8_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain OA； PDBConstruct 1–466； UniProt 1–466

S-phase kinase-associated protein 1

OrganismNot specified

UniProt Q9WTX5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） Expressed sequence C85627 × 1 （Q3TSA9） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SKP1_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain QA； PDBConstruct 1–163； UniProt 1–163 Author chain QB； PDBConstruct 1–163； UniProt 1–163 Author chain QC； PDBConstruct 1–163； UniProt 1–163

Expressed sequence C85627

OrganismNot specified

UniProt Q3TSA9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） F-box and WD-40 domain protein 21 × 1 （Q8BI38） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q3TSA9_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain NA； PDBConstruct 1–469； UniProt 1–469

F-box and WD-40 domain protein 21

OrganismNot specified

UniProt Q8BI38

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 33	Tubulin beta-4B chain × 1 （P68372） NACHT, LRR and PYD domains-containing protein 5 × 2 （Q9R1M5） Oocyte-expressed protein homolog × 2 （Q9CWE6） Transducin-like enhancer protein 6 × 2 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） KH domain-containing protein 3 × 1 （Q9CWU5） NLR family, pyrin domain containing 4F × 1 （L7N1W9） Inactive protein-arginine deiminase type-6 × 10 （Q8K3V4） Tubulin alpha-1C chain × 1 （P68373） NACHT, LRR and PYD domains-containing protein 14 × 2 （Q6B966） E3 ubiquitin-protein ligase UHRF1 × 2 （Q8VDF2） Ubiquitin-conjugating enzyme E2 D3 × 2 （P61079） F-box and WD-40 domain protein 19 × 1 （Q8C2W8） S-phase kinase-associated protein 1 × 3 （Q9WTX5） Expressed sequence C85627 × 1 （Q3TSA9） GUANOSINE-5'-TRIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 11 CALCIUM ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8BI38_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain PA； PDBConstruct 1–468； UniProt 1–468

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	12dl
Deposition date deposition_date	2026-03-29
Structure title title	Native structure of the cytoplasmic lattice (CPL) asymmetric unit from mouse MII eggs
Keywords keywords	cytoplasmic lattice, egg, filamentous assembly, CYTOSOLIC PROTEIN; CYTOSOLIC PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

12dl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

12dl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

12dl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	105.40 Å
Total Rg	105.40 Å
Atom count	133296
Residues	16739
Excluded volume	2388200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`12dl__assembly_1__model_1`	33-meric （33）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (20)

Entity 1 Entity 1 polymer

Description description	Tubulin beta-4B chain
Molecular weight formula_weight	49877.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	FA
Atom count atom_count	133296

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

Entity 2 Entity 2 polymer

Description description	NACHT, LRR and PYD domains-containing protein 5
Molecular weight formula_weight	131468.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GB,GA

MGPPEKESKAILKARGLEEEQKSERKMTSPENDSKSIQKDQGPEQEQTSESTMGPPEKESKAILKARGLEEEQKSERKMTSPENDSKSIQKDQGPEQEQTSESTMGPPEKDSKAILKARGLEEEQKSESTMSPSENVSRAILKDSGSEEVEQASERKMTSPENDSKSIQKDQGPEQEQTSETLQSKEEDEVTEADKDNGGDLQDYKAHVIAKFDTSVDLHYDSPEMKLLSDAFKPYQKTFQPHTIILHGRPGVGKSALARSIVLGWAQGKLFQKMSFVIFFSVREIKWTEKSSLAQLIAKECPDSWDLVTKIMSQPERLLFVIDGLDDMDSVLQHDDMTLSRDWKDEQPIYILMYSLLRKALLPQSFLIITTRNTGLEKLKSMVVSPLYILVEGLSASRRSQLVLENISNESDRIQVFHSLIENHQLFDQCQAPSVCSLVCEALQLQKKLGKRCTLPCQTLTGLYATLVFHQLTLKRPSQSALSQEEQITLVGLCMMAAEGVWTMRSVFYDDDLKNYSLKESEILALFHMNILLQVGHNSEQCYVFSHLSLQDFFAALYYVLEGLEEWNQHFCFIENQRSIMEVKRTDDTRLLGMKRFLFGLMNKDILKTLEVLFEYPVIPTVEQKLQHWVSLIAQQVNGTSPMDTLDAFYCLFESQDEEFVGGALKRFQEVWLLINQKMDLKVSSYCLKHCQNLKAIRVDIRDLLSVDNTLELCPVVTVQETQCKPLLMEWWGNFCSVLGSLRNLKELDLGDSILSQRAMKILCLELRNQSCRIQKLTFKSAEVVSGLKHLWKLLFSNQNLKYLNLGNTPMKDDDMKLACEALKHPKCSVETLRLDSCELTIIGYEMISTLLISTTRLKCLSLAKNRVGVKSMISLGNALSSSMCLLQKLILDNCGLTPASCHLLVSALFSNQNLTHLCLSNNSLGTEGVQQLCQFLRNPECALQRLILNHCNIVDDAYGFLAMRLANNTKLTHLSLTMNPVGDGAMKLLCEALKEPTCYLQELELVDCQLTQNCCEDLACMITTTKHLKSLDLGNNALGDKGVITLCEGLKQSSSSLRRLGLGACKLTSNCCEALSLAISCNPHLNSLNLVKNDFSTSGMLKLCSAFQCPVSNLGIIGLWKQEYYARVRRQLEEVEFVKPHVVIDGDWYASDEDDRNWWKN

Entity 3 Entity 3 polymer

Description description	Oocyte-expressed protein homolog
Molecular weight formula_weight	18481.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	IA,JA

MASHTADADAKPDSDSQKLLNVLPVSLRLRTRPWWFPIQEVSNPLVLYMEAWVAERVIGTDQAEISEIEWMCQALLTVDSVNSGNLAEITIFGQPSAQTRMKNILLNMAAWHKENELQRAVKVKEVEEFLKIRASSILSKLSKKGLKLAGFPLPLEGRETQMES

Entity 4 Entity 4 polymer

Description description	Transducin-like enhancer protein 6
Molecular weight formula_weight	65187.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	HB,HA

MTSHRQSSDTFGGILPSTLSSRYLSIVNQLPEEFSSVVSEMMVHLENIFSLAENFFQAIERFSRTPDLLERNKMSIGVGAEGDSWPCHVSHEAPMGSAQTTENSAKEEDKQVPESAALQHPKFKSTPGPQLPTRRRFLSESDELQDPQPVWDAEPQFCQGFLIQGLWELFMDSRQKNQQEHGGEDSSQESKDSGLCDFKPEPQPRHRNSLSDSADPFLIKSPSALLDYYQEDVSRPQPETQESSGRADKFLKPLSWGSEVLESSCNQPSTALWQLERFTVPQALQKVRVLKHQELLLVVAVSSFTRHVFTCSQSGIKVWNLVNQVAEDRDPESHLKCSVQDNKVYLRTCLLSSNSRTLFAGGYNLPGVIVWDLAAPSLYEKCQLPCEGLSCQALANTKENMALAGFTDGTVRIWDLRTQEIVRNLKGPTNSARNLVVKDDNIWTGGLDACLRCWDLRMAKVSLEHLFQSQIMSLAHSPTEDWLLLGLANGQHCLFNSRKRDQVLTVDTKDNTILGLKFSPNGKWWASVGMGNFITVHSMPTGAKLFQVPEVGPVRCFDMTENGRLIITGSRDCASVYHIKY

Entity 5 Entity 5 polymer

Description description	Zinc finger BED domain-containing protein 3
Molecular weight formula_weight	25512.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	KA

KSKKPLKITMEDSRRLNDPAEQGGLCPAPVGPSYSEAWGYFHLDPAQPRHRMMSAWATCRLCGLQVGGLPNFQMWTRALCQHLSDVHLPELKKSAAPSSPTTMPCPPPPSPTMAAEGDWARLLEQMGELAMRGSQRELELERREAALMQAELELERKRQALKQEAQSVEQERHQLQVEREALSKWIKKQSPGAQVPEPPSPLPLLPKEDPDIHDNNSDNDMVTKVLL

Entity 6 Entity 6 polymer

Description description	KH domain-containing protein 3
Molecular weight formula_weight	48055.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	LA

MASLKRFQTLVPLDHKQGTLFEIIGEPKLPKWFHVECLEDPKRLYVEPRLLEIMFGKDGEHIPHLESMLHTLIHVNVWGPERRAEIWIFGPPPFRRDVDRMLTDLAHYCRMKLMEIEALEAGVERRRMAAHKAATQPAPVKVREAAPRPASVKVPETATQPAPVKVREAAPQPAPVQEVREAAPQQASVQEEVREAATEQAPVQEVREAATEQAPVQEVSEAATEQAPVQEVNEAATEQASVQAVREAATRPAPGKVRKAATQPAPVQVCQEATQLAPVKVREAATQPASGKVREAATQLAPVKVRKAATQLAPVKVHEAATQPAPGKVSDAATQSASVQVREAATQLSPVEATDTSQLAQVKADEAFAQHTSGEAHQVANGQSPIEVCETATGQHSLDVSRALSQKCPEVFEWETQSCLDGSYVIVQPPRDAWESFIIL

Entity 7 Entity 7 polymer

Description description	NLR family, pyrin domain containing 4F
Molecular weight formula_weight	108001.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	MA

MASFISDFGLIWYLRELNKKEFMKFKDFLIQEILELKLKQVSSTKVKKASREDLANLLLKCGENQAWDMTFRILQKINRKDLTERATGAIVGNPNLYRDHLKKKLTHDCPKKFNVRIQDFIKETFIQNDYDAFENLLISKGTERKPHMVFLKGMAGVGKTLMLKNLMLAWSKGLVFQNKFSYAFYFCCQDVKQLKTASLAELISREWPSPSAPIEEILSQPEKLLFIIDSLEGMEWDLTKQESELCDDCMEKQPVSTLLSSLLRRKMLPESSLLLSTTPETFEKMEDRIQCTDVKTATAFDERSMKIYFHRLFQDRKRAQEAFSLVRENKQLFTICQVPLLCWMVATCLKEEIEKGGDPVSLCRRTTSLYTTHIFSLFIPQSAQYPSKKSQDQLQGLCSLAAEGMWTDTFVFGKEALRRNGIFDSDIPTLLDIGMLGKIREFENSYIFLHPSVQEVCAAIFYMLKRHVEHPSQDVKNIETVLFMFLKKVKTQWIFLGCFIFGLLQKSEQEKLGVFFGHRLSKNIHHKLYQCLETLSGNAELQEQIDGMRLFSCLFEMEDEAFLVKAMNCMQQINFVAKNYSDFIVAAYCLKHCSTLKKLSFSTENVLNEGDQSYMEELLICWNNMCSVFVRSKDIQELRIKDTNFNEPAIRVLYESLKYPSFTLNKLVANNVSFGDNHVLFELIQNSSLQYLDLSCSFLSHNEVKLLCDILNQAECNIEKLMIAHCKLSPDDCKIFGSILMSSKSLKVLNLASNNLNQGISSLCKALCHPHCTLEYLVLSNCSLSEQCWDYLSEVLRQNKTLSHLDISSNDLKDEGLKILCRSLILPYCVLESLCLSCCGITERGCQDLAEVLKNNQNLKYLHVSYNKLKDTGVMLLCDAIKHPNCHLKDLQLEACEITDASNEELCYAFMQCETLQTLNLMGNAFEVSRMVFFPRF

Entity 8 Entity 8 polymer

Description description	Inactive protein-arginine deiminase type-6
Molecular weight formula_weight	76854.1 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC,AD,AE,AF,AG,AH,AA,AB,AI,AJ

MSFQNSLSLSLVNPTHALCMVGMEITLDISKCAPDKCKSFTIRGSPRILIHISSSVIAGKEDTVVWRSMNHPTVALVRMVAPSPTVDEDKVLVSYFCPDQEVPTATAVLFLTGIEISLEADIYRDGQLDMPSDKQAKKKWMWGMNGWGAILLVNCSPNAVGQPDEQSFQEGPREIQNLSQMNVTVEGPTSILQNYQLILHTSEEEAKKTRVYWSQRGSSAYELVVGPNKPVYLLPTFENRRKEAFYVEATEFPSPSFSGLISLSLSLVEKAHDECIPEIPLYKDTVMFRVAPYIFMPSTQMPLEVYLCRELQLQGFVDSVTKLSEKSKVQVVKVYEDPNRQSKWLQDEMAFCYTQAPHKTVSLILDTPRVSKLEDFPMKYTLTPGSGYLIRQTEDHRVASLDSIGNLMVSPPVKAQGKDYPLGRVLIGGSFYPSSEGRDMNKGLREFVYAQQVQAPVELFSDWLMTGHMDQFMCFVPTNDKNNDQKDFRLLLASPSACFELFEQKQKEGYGNVTLFEDIGAEQLLSNGRESKTISQILADKSFREQNTYVEKCISLNRTLLKTELGLEDKDIILIPQLFCLEQLTNVPSNQQSTKLFARPYFPDMLQIIVLGKNLGIPKPFGPKINGTCCLEEKVCGLLEPLGLKCTFIDDFDCYLANIGDVCASAIINRVPFAFKWWKMTP

Entity 9 Entity 9 polymer

Description description	Tubulin alpha-1C chain
Molecular weight formula_weight	49962.2 kDa
EC 编号 ec_number	3.6.5.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	EA

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSAEGDDEGEEY

Entity 10 Entity 10 polymer

Description description	NACHT, LRR and PYD domains-containing protein 14
Molecular weight formula_weight	113527.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	DA,DB

MKTEDDEMEYEASKEETVSEDKDFDDGIDYRTVIKENIFTMWYKTSLHGEFATLNCVITPKDQNLLQHIFDEDIQTSEAPQTVVLQGAAGIGKTTLLKKAVLEWADGNLYQQFTHVFYLNGKEISQVKEKSFAQLISKHWPSSEGPIEQVLSKPSSLLFIIDSFDELDFSFEEPQFALCKDWTQISPVSFLISSLLRKVMLPESYLLVATRSTAWKRLVPLLQKPQRVKLSGLSKNARMDYIHHLLKDKAWATSAIYSLRMNWRLFHMCHVCHMCQMICAVLKGQVEKGGRVEETCKTSTALFTYYICSLFPRIPVGCVTLPNETLLRSLCKAAVEGIWTMKHVLYQQNLRKHELTREDILLFLDAKVLQQDTEYENCYMFTHLHVQEFFAALFYLLRENLEEQDYPSEPFENLYLLLESNHIHDPHLEQMKCFLFGLLNKDRVRQLEETFNLTISMEVREELLACLEGLEKDDSSLSQLRFQDLLHCIYETQDQEFITQALMYFQKIIVRVDEEPQLRIYSFCLKHCHTLKTMRLTARADLKNMLDTAEMCLEGAAVQVIHYWQDLFSVLHTNESLIEMDLYESRLDESLMKILNEELSHPKCKLQKLIFRAVDFLNGCQDFTFLASNKKVTHLDLKETDLGVNGLKTLCEALKCKGCKLRVLRLASCDLNVARCQKLSNALQTNRSLVFLNLSLNNLSNDGVKSLCEVLENPNSSLERLALASCGLTKAGCKVLSSALTKSKRLTHLCLSDNVLEDEGIKLLSHTLKHPQCTLQSLVLRSCSFTPIGSEHLSTALLHNRSLVHLDLGQNKLADNGVKLLCHSLQQPHCNLQELELMSCVLTSKACGDLASVLVNNSNLWSLDLGHNILDDAGLNILCDALRNPNCHVQRLGLENCGLTPGCCQDLLGILSNNKSVIQMNLMKNALDHESIKNLCKVLRSPTCKMEFLALDKKEILKKKIKKFLVDVRINNPHLVIGPECPNTESGCWWNYF

Entity 11 Entity 11 polymer

Description description	E3 ubiquitin-protein ligase UHRF1
Molecular weight formula_weight	88436.8 kDa
EC 编号 ec_number	2.3.2.27
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BA,BB

MWIQVRTMDGKETHTVNSLSRLTKVQELRKKIEEVFHVEPQLQRLFYRGKQMEDGHTLFDYDVRLNDTIQLLVRQSLALPLSTKERDSELSDSDSGYGVGHSESDKSSTHGEGAAEADDKTVWEDTDLGLYKVNEYVDVRDNIFGAWFEAQVVQVQKRALSEDEPCSSSAVKTSEDDIMYHVKYDDYPEHGVDIVKAKNVRARARTVIPWENLEVGQVVMANYNVDYPRKRGFWYDVEICRKRQTRTARELYGNIRLLNDSQLNNCRIMFVDEVLMIELPKERRPLIASPSQPPPALRNTGKSGPSCRFCKDDENKPCRKCACHVCGGREAPEKQLLCDECDMAFHLYCLKPPLTSVPPEPEWYCPSCRTDSSEVVQAGEKLKESKKKAKMASATSSSRRDWGKGMACVGRTTECTIVPANHFGPIPGVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGRDLSGNKRTAGQSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREGKDRTRQLGLTMQYPEGYLEALANKEKSRKRPAKALEQGPSSSKTGKSKQKSTGPTLSSPRASKKSKLEPYTLSEQQANLIKEDKGNAKLWDDVLTSLQDGPYQIFLSKVKEAFQCICCQELVFRPVTTVCQHNVCKDCLDRSFRAQVFSCPACRFELDHSSPTRVNQPLQTILNQLFPGYGSGR

Entity 12 Entity 12 polymer

Description description	Ubiquitin-conjugating enzyme E2 D3
Molecular weight formula_weight	16706.1 kDa
EC 编号 ec_number	2.3.2.23,2.3.2.24
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CA,CB

MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Entity 13 Entity 13 polymer

Description description	F-box and WD-40 domain protein 19
Molecular weight formula_weight	53657.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	OA

MEIHLPSLPMMKILSYLDAYSLLQAAKVNKNWNELASSDVLWRKLCQKRWLYCDRVTLQLHGLETWKQFFISRTWQEHAKTRAKPEDFNYKEIPVAFEFRAHPCYISRHGLIRNGQGKSAVCMVTSTNRISTWDVHEGAMTWVSPVQPSYITRMTTLPEMHIAVTIDMQSNIKLWDCHNRKVLATTGLLSSCQLLQAVFTNDSPIVLVGDILGNLYIFRIPDLHLISKVNVFPYGIDELHCSPQKKWVLLIGKQRHVLTKVFYMSSLLRTSEFSAPVSTDLKFSLCQRAFWTPRREDRITLMSSTIPPDPTKFATFDMKLEEIENKVTIQGHLVASFSLQDCKERAEWMGVSDKDVIVCSTGSSLLLFDINGLRLQTFQYCPEEILRLCVDPVHVIVTCNNGSLDVYVWEERSPLLRRCYRLRKRGYLPLSGFIIKTLCDESSIILVMTSSPIPCFLMAYTLKVCS

Entity 14 Entity 14 polymer

Description description	S-phase kinase-associated protein 1
Molecular weight formula_weight	18694.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	QB,QA,QC

MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Entity 15 Entity 15 polymer

Description description	Expressed sequence C85627
Molecular weight formula_weight	54205.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	NA

METHLPSLPSLPMMKILSYLDAYSLLQVAQVNKNWNALASSDVLWRKLCQKRWLYCDTVILQLHDKETWKQFFVNRTYQEHTKTRAKPEDFTYKEICAETGIWAYACYISGRGLTRNGQGTSVVCMLTSMTKISTWDIHEGVMTWVSPVQPTTIKLLNTLPEMHIAVTVDIHSTIKLWDCNSSDALATNNLFFPCQTLKSVFTKDAAIVLVSDTLGNLYIFRIPDLHLISTINVFPYGINELYCSPQKKWVFLSRKHPHILPKVFYMNSLLRRSEFSAPVSTVLNFSLCDKAFWTPRKEDRITLMSISAPYKVTKFVTFDMKLEEIGNQIIVTGYLIASFSLTDYEGRLECFGVSDKDVIVCSTGSSLLLFSIYGVCLQTFDYCSEEILRLWVDPFHVIVTFIDGSLDVYAWEERCQQLSKCYRLQNRRRLPRQSCFEKTLCDEVSIIRMVRNGRNPCYLMTYTLNIHS

Entity 16 Entity 16 polymer

Description description	F-box and WD-40 domain protein 21
Molecular weight formula_weight	54517.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	PA

MEIHLPRLPLMEIFSYLDAYSLLQVAQVNKNWNELASSDVLWRKLCQKRWFYCNMVTQQLLGKETWKEFFIYRTWQEHAKSRAKPEDFIYKEIPAEYGIQAYACYISEHGLTRNGQGRSVICMATSMNRISTWDIHEGVLTWVSPEQPASIKLLTTLPEMYIAVTVDMESTIKLWDCHNSEALATNSLISPCQSLKAVITKDGPIVLIGDTLGNLNIFRIPDLYHITRLKVFPYGISELYCSPQKKWIFLNRKHPHILPKVFYMSSLLRTSEFSAPVSTDLKFSLCQRAFWTPRREDRITLMSIHGPKKIKKFITFDMELEKIGNKITVKEHFFASFSLQNYEERPEWYGVSDKDVIVCSTRFSLLLFDINGHCLQAFQYCPEQILRLWVDPLHVIVSCNDGFLDVYAWEERSQQLNKCYRLQYSKHLPSSGLINKTLSDDVSIIQVITIRTTPCFLMAFILKSALEN

Entity 17 Entity 17 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 18 Entity 18 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	11

Entity 20 Entity 20 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.500 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	249541

Native structure of the cytoplasmic lattice (CPL) asymmetric unit from mouse MII eggs

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin beta-4B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NACHT, LRR and PYD domains-containing protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Oocyte-expressed protein homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transducin-like enhancer protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Zinc finger BED domain-containing protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

KH domain-containing protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NLR family, pyrin domain containing 4F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inactive protein-arginine deiminase type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin alpha-1C chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NACHT, LRR and PYD domains-containing protein 14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer