8i7o

In situ structure of axonemal doublet microtubules in mouse sperm with 16-nm repeat

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tektin-1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A2； PDBConstruct 1–418； UniProt 1–418 Author chain A3； PDBConstruct 1–418； UniProt 1–418

Detyrosinated tubulin alpha-3 chain

OrganismNot specified

UniProt P05214

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA3_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AE； PDBConstruct 1–438； UniProt 1–438 Author chain AG； PDBConstruct 1–438； UniProt 1–438 Author chain AI； PDBConstruct 1–438； UniProt 1–438 Author chain BE； PDBConstruct 1–438； UniProt 1–438 Author chain BG； PDBConstruct 1–438； UniProt 1–438 Author chain BI； PDBConstruct 1–438； UniProt 1–438 Author chain CG； PDBConstruct 1–438； UniProt 1–438 Author chain CI； PDBConstruct 1–438； UniProt 1–438 Author chain DE； PDBConstruct 1–438； UniProt 1–438 Author chain DG； PDBConstruct 1–438； UniProt 1–438 Author chain EE； PDBConstruct 1–438； UniProt 1–438 Author chain EG； PDBConstruct 1–438； UniProt 1–438 Author chain FE； PDBConstruct 1–438； UniProt 1–438 Author chain FG； PDBConstruct 1–438； UniProt 1–438 Author chain GE； PDBConstruct 1–438； UniProt 1–438 Author chain GG； PDBConstruct 1–438； UniProt 1–438 Author chain GI； PDBConstruct 1–438； UniProt 1–438 Author chain HE； PDBConstruct 1–438； UniProt 1–438 Author chain HG； PDBConstruct 1–438； UniProt 1–438 Author chain HI； PDBConstruct 1–438； UniProt 1–438 Author chain IE； PDBConstruct 1–438； UniProt 1–438 Author chain IG； PDBConstruct 1–438； UniProt 1–438 Author chain II； PDBConstruct 1–438； UniProt 1–438 Author chain JE； PDBConstruct 1–438； UniProt 1–438 Author chain JG； PDBConstruct 1–438； UniProt 1–438 Author chain KE； PDBConstruct 1–438； UniProt 1–438 Author chain KG； PDBConstruct 1–438； UniProt 1–438 Author chain KI； PDBConstruct 1–438； UniProt 1–438 Author chain LE； PDBConstruct 1–438； UniProt 1–438 Author chain LG； PDBConstruct 1–438； UniProt 1–438 Author chain LI； PDBConstruct 1–438； UniProt 1–438 Author chain ME； PDBConstruct 1–438； UniProt 1–438 Author chain MG； PDBConstruct 1–438； UniProt 1–438 Author chain MI； PDBConstruct 1–438； UniProt 1–438 Author chain NE； PDBConstruct 1–438； UniProt 1–438 Author chain NG； PDBConstruct 1–438； UniProt 1–438 Author chain NI； PDBConstruct 1–438； UniProt 1–438 Author chain OE； PDBConstruct 1–438； UniProt 1–438 Author chain OG； PDBConstruct 1–438； UniProt 1–438 Author chain OI； PDBConstruct 1–438； UniProt 1–438 Author chain PE； PDBConstruct 1–438； UniProt 1–438 Author chain PG； PDBConstruct 1–438； UniProt 1–438 Author chain PI； PDBConstruct 1–438； UniProt 1–438 Author chain QE； PDBConstruct 1–438； UniProt 1–438 Author chain QG； PDBConstruct 1–438； UniProt 1–438 Author chain QI； PDBConstruct 1–438； UniProt 1–438 Author chain RE； PDBConstruct 1–438； UniProt 1–438 Author chain RG； PDBConstruct 1–438； UniProt 1–438 Author chain RI； PDBConstruct 1–438； UniProt 1–438 Author chain SE； PDBConstruct 1–438； UniProt 1–438 Author chain SG； PDBConstruct 1–438； UniProt 1–438 Author chain SI； PDBConstruct 1–438； UniProt 1–438 Author chain TG； PDBConstruct 1–438； UniProt 1–438 Author chain TI； PDBConstruct 1–438； UniProt 1–438 Author chain UE； PDBConstruct 1–438； UniProt 1–438 Author chain UG； PDBConstruct 1–438； UniProt 1–438 Author chain VE； PDBConstruct 1–438； UniProt 1–438 Author chain VG； PDBConstruct 1–438； UniProt 1–438 Author chain WE； PDBConstruct 1–438； UniProt 1–438 Author chain WG； PDBConstruct 1–438； UniProt 1–438 Author chain WI； PDBConstruct 1–438； UniProt 1–438

Tubulin beta-4B chain

OrganismNot specified

UniProt P68372

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB4B_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AF； PDBConstruct 1–427； UniProt 1–427 Author chain AH； PDBConstruct 1–427； UniProt 1–427 Author chain BF； PDBConstruct 1–427； UniProt 1–427 Author chain BH； PDBConstruct 1–427； UniProt 1–427 Author chain CF； PDBConstruct 1–427； UniProt 1–427 Author chain CH； PDBConstruct 1–427； UniProt 1–427 Author chain CJ； PDBConstruct 1–427； UniProt 1–427 Author chain DD； PDBConstruct 1–427； UniProt 1–427 Author chain DF； PDBConstruct 1–427； UniProt 1–427 Author chain DH； PDBConstruct 1–427； UniProt 1–427 Author chain ED； PDBConstruct 1–427； UniProt 1–427 Author chain EF； PDBConstruct 1–427； UniProt 1–427 Author chain EH； PDBConstruct 1–427； UniProt 1–427 Author chain FD； PDBConstruct 1–427； UniProt 1–427 Author chain FF； PDBConstruct 1–427； UniProt 1–427 Author chain FH； PDBConstruct 1–427； UniProt 1–427 Author chain GD； PDBConstruct 1–427； UniProt 1–427 Author chain GF； PDBConstruct 1–427； UniProt 1–427 Author chain GH； PDBConstruct 1–427； UniProt 1–427 Author chain HD； PDBConstruct 1–427； UniProt 1–427 Author chain HF； PDBConstruct 1–427； UniProt 1–427 Author chain HH； PDBConstruct 1–427； UniProt 1–427 Author chain IF； PDBConstruct 1–427； UniProt 1–427 Author chain IH； PDBConstruct 1–427； UniProt 1–427 Author chain JD； PDBConstruct 1–427； UniProt 1–427 Author chain JF； PDBConstruct 1–427； UniProt 1–427 Author chain JH； PDBConstruct 1–427； UniProt 1–427 Author chain KD； PDBConstruct 1–427； UniProt 1–427 Author chain KF； PDBConstruct 1–427； UniProt 1–427 Author chain KH； PDBConstruct 1–427； UniProt 1–427 Author chain LD； PDBConstruct 1–427； UniProt 1–427 Author chain LF； PDBConstruct 1–427； UniProt 1–427 Author chain LH； PDBConstruct 1–427； UniProt 1–427 Author chain MF； PDBConstruct 1–427； UniProt 1–427 Author chain MH； PDBConstruct 1–427； UniProt 1–427 Author chain ND； PDBConstruct 1–427； UniProt 1–427 Author chain NF； PDBConstruct 1–427； UniProt 1–427 Author chain NH； PDBConstruct 1–427； UniProt 1–427 Author chain OD； PDBConstruct 1–427； UniProt 1–427 Author chain OF； PDBConstruct 1–427； UniProt 1–427 Author chain OH； PDBConstruct 1–427； UniProt 1–427 Author chain PF； PDBConstruct 1–427； UniProt 1–427 Author chain PH； PDBConstruct 1–427； UniProt 1–427 Author chain QF； PDBConstruct 1–427； UniProt 1–427 Author chain QH； PDBConstruct 1–427； UniProt 1–427 Author chain RF； PDBConstruct 1–427； UniProt 1–427 Author chain RH； PDBConstruct 1–427； UniProt 1–427 Author chain RJ； PDBConstruct 1–427； UniProt 1–427 Author chain SF； PDBConstruct 1–427； UniProt 1–427 Author chain SH； PDBConstruct 1–427； UniProt 1–427 Author chain SJ； PDBConstruct 1–427； UniProt 1–427 Author chain TF； PDBConstruct 1–427； UniProt 1–427 Author chain TH； PDBConstruct 1–427； UniProt 1–427 Author chain TJ； PDBConstruct 1–427； UniProt 1–427 Author chain UD； PDBConstruct 1–427； UniProt 1–427 Author chain UF； PDBConstruct 1–427； UniProt 1–427 Author chain UH； PDBConstruct 1–427； UniProt 1–427 Author chain VD； PDBConstruct 1–427； UniProt 1–427 Author chain VF； PDBConstruct 1–427； UniProt 1–427 Author chain VH； PDBConstruct 1–427； UniProt 1–427 Author chain WF； PDBConstruct 1–427； UniProt 1–427 Author chain WH； PDBConstruct 1–427； UniProt 1–427

Tektin-2

OrganismNot specified

UniProt Q922G7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT2_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B2； PDBConstruct 1–430； UniProt 1–430 Author chain B3； PDBConstruct 1–430； UniProt 1–430 Author chain B7； PDBConstruct 1–430； UniProt 1–430 Author chain B8； PDBConstruct 1–430； UniProt 1–430

Tektin-3

OrganismNot specified

UniProt Q6X6Z7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT3_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain C2； PDBConstruct 1–490； UniProt 1–490 Author chain C3； PDBConstruct 1–490； UniProt 1–490 Author chain C4； PDBConstruct 1–490； UniProt 1–490 Author chain C7； PDBConstruct 1–490； UniProt 1–490 Author chain C8； PDBConstruct 1–490； UniProt 1–490 Author chain Cb； PDBConstruct 1–490； UniProt 1–490 Author chain Cc； PDBConstruct 1–490； UniProt 1–490

Tektin-4

OrganismNot specified

UniProt Q149S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT4_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain D2； PDBConstruct 1–447； UniProt 1–447 Author chain D3； PDBConstruct 1–447； UniProt 1–447 Author chain D4； PDBConstruct 1–447； UniProt 1–447 Author chain D7； PDBConstruct 1–447； UniProt 1–447 Author chain D8； PDBConstruct 1–447； UniProt 1–447 Author chain D9； PDBConstruct 1–447； UniProt 1–447

Tektin bundle-interacting protein 1

OrganismNot specified

UniProt A6H6Q4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TKTI1_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain E2； PDBConstruct 1–206； UniProt 1–206 Author chain E3； PDBConstruct 1–206； UniProt 1–206

Tektin-5

OrganismNot specified

UniProt G5E8A8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT5_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain F2； PDBConstruct 1–557； UniProt 1–557 Author chain F3； PDBConstruct 1–557； UniProt 1–557 Author chain F6； PDBConstruct 1–557； UniProt 1–557 Author chain F7； PDBConstruct 1–557； UniProt 1–557 Author chain Fa； PDBConstruct 1–557； UniProt 1–557 Author chain Fb； PDBConstruct 1–557； UniProt 1–557 Author chain Fc； PDBConstruct 1–557； UniProt 1–557 Author chain Fl； PDBConstruct 1–557； UniProt 1–557

EF-hand domain-containing protein 1

OrganismNot specified

UniProt Q9D9T8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC1_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain G1； PDBConstruct 1–648； UniProt 1–648 Author chain G2； PDBConstruct 1–648； UniProt 1–648

EF-hand domain-containing family member C2

OrganismNot specified

UniProt Q9D485

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC2_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain G5； PDBConstruct 1–750； UniProt 1–750

Protein FAM166A

OrganismNot specified

UniProt Q9D4K5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F166A_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain H3； PDBConstruct 1–319； UniProt 1–319 Author chain H4； PDBConstruct 1–319； UniProt 1–319

Protein FAM166C

OrganismNot specified

UniProt Q9DAS2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F166C_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain I2； PDBConstruct 1–200； UniProt 1–200 Author chain I3； PDBConstruct 1–200； UniProt 1–200

Dual specificity phosphatase 21

OrganismNot specified

UniProt Q9D9D8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DUS21_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain J2； PDBConstruct 1–189； UniProt 1–189 Author chain J3； PDBConstruct 1–189； UniProt 1–189

Coiled-coil domain-containing protein 105

OrganismNot specified

UniProt Q9D4K7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CC105_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain K2； PDBConstruct 1–499； UniProt 1–499 Author chain K3； PDBConstruct 1–499； UniProt 1–499 Author chain K4； PDBConstruct 1–499； UniProt 1–499

Enkurin

OrganismNot specified

UniProt Q6SP97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ENKUR_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain L2； PDBConstruct 1–255； UniProt 1–255 Author chain L3； PDBConstruct 1–255； UniProt 1–255

Testis-expressed protein 43

OrganismNot specified

UniProt Q9D9I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEX43_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain M2； PDBConstruct 1–141； UniProt 1–141 Author chain M3； PDBConstruct 1–141； UniProt 1–141

Cilia- and flagella-associated protein 276

OrganismNot specified

UniProt Q9DAD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF276_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain N2； PDBConstruct 1–168； UniProt 1–168 Author chain N3； PDBConstruct 1–168； UniProt 1–168

Protein Flattop

OrganismNot specified

UniProt Q6P8X9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLTOP_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain O1； PDBConstruct 1–189； UniProt 1–189 Author chain O2； PDBConstruct 1–189； UniProt 1–189

Cilia- and flagella-associated protein 52

OrganismNot specified

UniProt Q5F201

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA52_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain P1； PDBConstruct 1–620； UniProt 1–620 Author chain P2； PDBConstruct 1–620； UniProt 1–620

EF-hand calcium-binding domain-containing protein 6

OrganismNot specified

UniProt Q6P1E8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFCB6_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain Q1； PDBConstruct 1–1516； UniProt 1–1516 Author chain Q2； PDBConstruct 1–1516； UniProt 1–1516

Cilia and flagella-associated protein 77

OrganismNot specified

UniProt A0A087WRI3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A087WRI3_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain R2； PDBConstruct 1–283； UniProt 1–283

Cilia- and flagella-associated protein 20

OrganismNot specified

UniProt Q8BTU1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Parkin coregulated gene protein homolog × 3 （Q9DAK2） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA20_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain XC； PDBConstruct 1–193； UniProt 1–193 Author chain XD； PDBConstruct 1–193； UniProt 1–193 Author chain XE； PDBConstruct 1–193； UniProt 1–193

Parkin coregulated gene protein homolog

OrganismNot specified

UniProt Q9DAK2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Sperm acrosome-associated protein 9 × 6 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PACRG_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain XJ； PDBConstruct 1–241； UniProt 1–241 Author chain XK； PDBConstruct 1–241； UniProt 1–241 Author chain XL； PDBConstruct 1–241； UniProt 1–241

Sperm acrosome-associated protein 9

OrganismNot specified

UniProt Q7TPM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 189	Tektin-1 × 2 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 61 （P05214） Tubulin beta-4B chain × 62 （P68372） Tektin-2 × 4 （Q922G7） Tektin-3 × 7 （Q6X6Z7） Tektin-4 × 6 （Q149S1） Tektin bundle-interacting protein 1 × 2 （A6H6Q4） Tektin-5 × 8 （G5E8A8） EF-hand domain-containing protein 1 × 2 （Q9D9T8） EF-hand domain-containing family member C2 × 1 （Q9D485） Protein FAM166A × 2 （Q9D4K5） Protein FAM166C × 2 （Q9DAS2） Dual specificity phosphatase 21 × 2 （Q9D9D8） Coiled-coil domain-containing protein 105 × 3 （Q9D4K7） Enkurin × 2 （Q6SP97） Testis-expressed protein 43 × 2 （Q9D9I1） Cilia- and flagella-associated protein 276 × 2 （Q9DAD0） Protein Flattop × 2 （Q6P8X9） Cilia- and flagella-associated protein 52 × 2 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 2 （Q6P1E8） Cilia and flagella-associated protein 77 × 1 （A0A087WRI3） Cilia- and flagella-associated protein 20 × 3 （Q8BTU1） Parkin coregulated gene protein homolog × 3 （Q9DAK2） GUANOSINE-5'-TRIPHOSPHATE × 123	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SACA9_MOUSE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain YI； PDBConstruct 1–168； UniProt 1–168 Author chain YJ； PDBConstruct 1–168； UniProt 1–168 Author chain YK； PDBConstruct 1–168； UniProt 1–168 Author chain YL； PDBConstruct 1–168； UniProt 1–168 Author chain YM； PDBConstruct 1–168； UniProt 1–168 Author chain YN； PDBConstruct 1–168； UniProt 1–168

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8i7o
Deposition date deposition_date	2023-02-01
Structure title title	In situ structure of axonemal doublet microtubules in mouse sperm with 16-nm repeat
Keywords keywords	microtubules, axoneme, sperm, filament, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8i7o__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8i7o__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8i7o__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	162.20 Å
Total Rg	162.10 Å
Atom count	540760
Residues	67953
Excluded volume	9554700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8i7o__assembly_1__model_1`	189-meric （189）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (25)

Entity 1 Entity 1 polymer

Description description	Tektin-1
Molecular weight formula_weight	48713.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A2,A3
Atom count atom_count	540760

MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIPPRDGDDHGAWEGGIRAEAIC

Entity 2 Entity 2 polymer

Description description	Detyrosinated tubulin alpha-3 chain
Molecular weight formula_weight	48689.1 kDa
Source method src_method	nat
Copy count entity_count	61

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;AE,AG,AI,BE,BG,BI,CG,CI,DE,DG,EE,EG,FE,FG,GE,GG,GI,HE,HG,HI,IE,IG,II,JE,JG,KE,KG,KI,LE,LG,LI,ME,MG,MI,NE,NG,NI,OE,OG,OI,PE,PG,PI,QE,QG,QI,RE,RG,RI,SE,SG,SI,TG,TI,UE,UG,VE,VG,WE,WG,WI ;

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD

Entity 3 Entity 3 polymer

Description description	Tubulin beta-4B chain
Molecular weight formula_weight	47897.9 kDa
Source method src_method	nat
Copy count entity_count	62

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	;AF,AH,BF,BH,CF,CH,CJ,DD,DF,DH,ED,EF,EH,FD,FF,FH,GD,GF,GH,HD,HF,HH,IF,IH,JD,JF,JH,KD,KF,KH,LD,LF,LH,MF,MH,ND,NF,NH,OD,OF,OH,PF,PH,QF,QH,RF,RH,RJ,SF,SH,SJ,TF,TH,TJ,UD,UF,UH,VD,VF,VH,WF,WH ;

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD

Entity 4 Entity 4 polymer

Description description	Tektin-2
Molecular weight formula_weight	50385.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B2,B3,B7,B8

MATLSFKPSERYRLSDWRTNSYLLSTNAERQRDASHQIRQEARILRNETNNQIVWDEHDNRTRLAERIDTVNRWKETLDKCLTDLDAEIDSLAQAKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVRDPVEEELLKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTSPNISLKVNPTRIPKDSTTLQQWDEFTRFNKNRAEAEMKASIELREAIALAIAQTNNELDAQRVATEFTFRKRLREMESFYSELKWQEKNTLEEIAELQGDIRRLEEDLRRKMMNLKLAHTRLESRTYRSNVELCRDQTQYGLIDEVHQLEATINTMKQKLAQTQNALDALFKHLARIQADIACKTNTLLLDTKCMDTRRKLTVPAEKFVPQVDTFTRTTNRTLSPLKICQLELT

Entity 5 Entity 5 polymer

Description description	Tektin-3
Molecular weight formula_weight	56754.8 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C2,C3,C4,C7,C8,Cb,Cc

MELLGSTLTATYAHPPPASASFLPAIGTITSSYKDRFPHRNLTHSLSLPWRPNTYYKTAYNYPTLAPYSSRSQRVCESTMLPFVSNRTTFFTRYTPDDWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSYPSTLRLVGYC

Entity 6 Entity 6 polymer

Description description	Tektin-4
Molecular weight formula_weight	52121.4 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D2,D3,D4,D7,D8,D9

MAQTGVLLTKEPAPQSIDVCELPRKEYEVACNTGAYTSSGLATAGFRTAKYLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRYPSVLQLAGYQ

Entity 7 Entity 7 polymer

Description description	Tektin bundle-interacting protein 1
Molecular weight formula_weight	23987.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E2,E3

MENVRREATRPSVPSGTLELYFPDHLYRNDYVSLEGPRWAPAIKQAVRWKFTPMGRDAAGQVWFTGLTNSEPGDAWYKLPRALDTPYREAHTRWHGCFQSRQRGLPPAYTQHLREMAFWDPAITAQYLNSGPRWGCMQWRDRQIRGKEFVVTRNQFGAKLPWRSDYVPLLSLPQRPRFTAQDFRQRGLQRPCPAIGQPPPAFTPAL

Entity 8 Entity 8 polymer

Description description	Tektin-5
Molecular weight formula_weight	62817.5 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F2,F3,F6,F7,Fa,Fb,Fc,Fl

MEFLGTTQTASFCGPKKGCGLQALPPAGQEPVVQECYQPFHLPGYRYLNAWRPSVFHKIATSQTIPEECSGIRRPPTILPSLRSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFRLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKSRLEHELAIKANTLCIDKDKCMSMRKSFPSTPRLTGYTCSAIGSGPYANHAPRISSGPCSGSALCKGPASCGGGASCGGGASCGGHAPCGSALCSHSVSRSGPGFAPVC

Entity 9 Entity 9 polymer

Description description	EF-hand domain-containing protein 1
Molecular weight formula_weight	75235.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G1,G2

MGTNPVHGLPFLPGSSFTDSTKTAFHRSQTLNYRNGYAVVRRPTMGIGGDRLHYNQLSQAELDELANKAPILTYGPLKQAPLAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDHYHWKDLNRGINLTVYGKTFRIVDCDRFTQDFLESQGIELNPSEKIPLDPYTQLRKEPVRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVLVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFGMPDLPPVDVTKKEPPPVKQELPPYNGYGLIEDSAQNCFALIPKAPRKDVVKMLMNDNKVLRYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVDNPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIQKPELPAPELESKQATGEPMVQGTEESKVQDLDALIDQIHMHLKYNSYKENLRETFQMYDKDESGYVDRETFFKICETLNVPVDDSLIKELIRLCTHGEGRINYYNFVRAFSN

Entity 10 Entity 10 polymer

Description description	EF-hand domain-containing family member C2
Molecular weight formula_weight	87758.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G5

MALPFLPGNSFNRNIGKERFHKSQHWGFCNNVRMLVSENKPGVGGDLLYGQKIKPKHSVFPKGDGTDAPSWVAFDKQVLSFDAYLEDEISDKRQEIFRIRYYKIYFYLEDDTIQVNEPEVINSGLPQGTSIRRQRIPYPPPNDDQFYTVYDFNINISVVFYGRTFKIYDCDPFTKNFLKKIGIKLNPPGQCPLDPYMKMRRETLEFVDPFRPYQSFDTLKRFIQYDGKVLRFFCLWDDSTSLFGDRREFVLHYFLCDGTVEIREVLPSNSGRDAMSSFLRRGKLPKYGPPGIYQPGQITDRAVLNVYGGLSEWRADGYLLDKYQLGKVEQDFYTDQDLSIGATINVWGRKVLLCDCDEFTKTYYRTKYGVDNFTPISCKPPHLPKIERKYPPYTGFGSEEDSFRSCVGLKPTPHRKNFKKFMELDSFGNISNILRYFGKLITHKCADVDRIFVIAFYLSDDTISVFEPIENNSGNAGGMFLKRSRVKKPGQEVFKSEFSEYIKAEELYIGATVNINGYLFILLNADEYTLNYMENNTDKFPYSNFELAIQKLKQEKSKSREITQVFAAADYNHTKVVPYNTFRDILMSITMGKLIDQELITIARHYRVPEIMDPDLAYLIARAHEKFKKNIFENFDMFIYNCVYEDREKKGVLPTKDIRRMCKSSRLPLDDDFLDCLLSRFEDKDHQINYEIFFSVLNWRMNPTPDLQAPPYLKEKCEDVWVGMPSPIPVKYVRYLDFLIDVYGLEDNML

Entity 11 Entity 11 polymer

Description description	Protein FAM166A
Molecular weight formula_weight	36659.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H3,H4

MTATQKHNLFTPEPHYIPGYAGFYPQLRYQVGNTYGRTTAQLLTDPSVQKSPCSVLSPMTKPKFIEDFSKSKPPWIPCRDLREPYIPHYTSLKPYKNFEILGQLPRQDVDTQGPPQVENRQGPLTAGFMPYPPYPACPPGRKGEARDLGHPGLLLAYGEEAWKDAAPLQDTPGKNNQLYHCRRDEYLPPHPPQETLDVGRFQRLPQLDHPNLIQRKAISGYAGFVPRFAWVMGMNYRDGVTQAMDDFDKNQFVFRHPVCALGERLPRTHWPNTTIYRSQGLIPFYMGFIPSMQDNYALTFGNSTRRAYQKELDRRSHTL

Entity 12 Entity 12 polymer

Description description	Protein FAM166C
Molecular weight formula_weight	23098.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I2,I3

MAFRSAGTLMTEFNAAFVPPALMPGYKGHVPGVASSFGSSYGNTTFKYFQDLRNTGLEKSYALLSGGCFPTIFSPNSPLVLTDNSQNWDRWLHQPTYSRSNQDNGRTTELTNFYKTVQQQRKYYQDKTGILSRVPYFVLPVKEPDRYPLPTDLPPLSEKSKWNLLRLSPDYKRTYQTFPSGKRVSSQERQRRDLYFEFRA

Entity 13 Entity 13 polymer

Description description	Dual specificity phosphatase 21
Molecular weight formula_weight	21527.6 kDa
EC 编号 ec_number	3.1.3.16,3.1.3.48
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J2,J3

MTTASCIFPSQATQQDNIYGLSQITASLFISNSAVANDKLTLSNNHITTIINVSAEVVNTFFEDIQYVQVPVSDAPNSYLYDFFDPIADHIHGVEMRNGRTLLHCAAGVSRSATLCLAYLMKYHNMTLLDAHTWTKTCRPIIRPNNGFWEQLIHYEFKLFSRNTVRMIYSPIGLIPNIYEKEAYLMELM

Entity 14 Entity 14 polymer

Description description	Coiled-coil domain-containing protein 105
Molecular weight formula_weight	57406.5 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K2,K3,K4

MPVLLPSTDPGQDSRVGAPEWRQAAKATSRKAHLLTDRCGQEAVTMWQPKDSVLDPNVAHHLGRAAYMEPWRFRVEMLKGGGTLEKPPPGEGVTLWKGKMKPPAWYARLPLPMHRDARAQQTAEVVHAHARGARLTAARLGRAQHQINGQLRLLLRQREATDRRLSEVRKGLLINQQSVKLRGYRPKCEKIPDKADSLLVWEKKELKSMKRKMEKDMEISEDLLKALASCRDTLDFYCQERLQAVELMNQPLDKVLEQAGRHSWVDITRPPTPRTQGLKTPPPDPIGTYTPACAKALFEAKRLLMESKDILTEMAKNEVDIQNQQQEISNRVCSSLAQKMRETLELKERMTMTLGLMRGTIHRCMKFNQEMYVTRGIIKGPLLKRNLEAREKLNRPLVRMYQRHVGTQLPEATRLAQGTDLLTRHNLHMEKNLKELRTTHDNLAWGLNCKKIGHDVDYDVVRLRLRQRHPHVCYEQAQRLVNDWDPPTPARSQTNTASK

Entity 15 Entity 15 polymer

Description description	Enkurin
Molecular weight formula_weight	29587.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L2,L3

MDSPCTSESIYNLIPSDLKEPPQHPRYTSLFRATIKNDMKKFKTAMKTMGPAKVEIPSPKDFLKKHSKEKTLPPKKKFNRCSPKKPAVPLRTDHPVMGIQSGKNFINTNAADVIMGVAKKPKPIYVDKRTGDKHDLETSGLFPKYINKKDYGITPEYICKRNEDVKKAQEEYDNYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSVPKKIRKQKLEKEMKQLEHDISVIEKHKIIYIANK

Entity 16 Entity 16 polymer

Description description	Testis-expressed protein 43
Molecular weight formula_weight	16305.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M2,M3

MASEKDDGPALPKLDDDNQTAENTCKPAEEQPQQLRWDDIHLPRFSLKQGMIPTRYVMPWKENMKFRNVNLQQAEACGIYAGPLEDSLFWGYSERLCHGEDRKAVLKKGLPEIKITDMPLHSPLSRYQSTVISHGFRRRLI

Entity 17 Entity 17 polymer

Description description	Cilia- and flagella-associated protein 276
Molecular weight formula_weight	18960.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N2,N3

MLQPQETFSNPALRDEDKHLGNLWASKKSLYKNPAHLAQQQDPWSRLSSTPTATSRSRDTFFDSKIPKDDLDFRLATLYNHHTGAFKNKTEILLHQETIEDIQGTKIQFPGECFHAPSAPITSRTTIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKNDGGFFST

Entity 18 Entity 18 polymer

Description description	Protein Flattop
Molecular weight formula_weight	20575.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O1,O2

MATNYSANQYEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLKIPPAKVTLTARTTTAADNLTKWIHKNPDLLNACNGLRPEISGKPFDPDSQTKQKKSVTKTVQQAPNPTIIPSSPVIQGDNPDEPQSSHPSAGHTPGPQTPVNSPNNPPPSPCKSTK

Entity 19 Entity 19 polymer

Description description	Cilia- and flagella-associated protein 52
Molecular weight formula_weight	68322.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P1,P2

MEEQVLPELDVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKVQLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFPFGTAELFATCAKKDIRVWHTMSKRELLRITVPNMTCHGIDFMRDGKSIISAWDDGKIRAFAPESGRLMYTINSAHRIGVTAIATTSDCKRIISGGGEGEVRVWQVGCQTQKLEEALKEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELEGSLSGSINGMDITQEGGHFVTGGHDHLVKVWDYNEGEVTHVGVGHSGNIMAMRISPGNQYIVSVSADGAILRWKYPFAS

Entity 20 Entity 20 polymer

Description description	EF-hand calcium-binding domain-containing protein 6
Molecular weight formula_weight	176028.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q1,Q2

MKRNGTRLNFAKANSTKSGSTRARDLMNKMSIIPEWHSLYSNTRKLPCSRPHSSPCKMQRTIFQDLCRPSSSTTAIANPVLSYLDIERILAQKISSRRDDIKKVFQILDRNHNQMVTKGDLKRVITAFLIPLTKDQFQDLLAQIPISSLGNVPYLEFLSRFGGGIDININGIKRVNENEVDNRRTVKEVQLTEKIFRNMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNLSVKNDASFKYLLSNAAELSRETQQGKNGKRLLDTGSSEDVWKNYSLDDLEKTFCQEFSKSYEKIEKALSAGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKTSTKINWKQFLTAIYERQKLEVSKTLPLKKRSSTEARNRSRKENIIKKLFKYSEDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFDPEGTGAVRVNSLLDVLDDSTKVRKMSPSTDTKTPLPVAWDSVEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQEAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERTQPSGEKTSEINNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVKINQEEFRKVLERSGMPMNDCQYAMLASKLGFKNEEGMSYQDFTMGFEDCMLSGLETVPLQSRTASRTNMDEHFISAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERFLSLLGLRLSVTLNFREFQNLCEKRPWKSDEAPQRLIRCKQKVADSELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLTPREFEKLWQNYDTEGRGYITYQEFLHRLGIRYSPKVHRPYKEDYFNFLGHFTKPKQVQEEIQELQQISEREKLMNHYEEISKAFNAMEKSKPVALCRVQKVLQECGCPLKEEELISLLKSLDVSVHNNHIDPVEFLRALEISWASKARPKEKEESSPPPISFSKVTPDEVIKTMQEVVESSQPALVEAFSALDKEDTGFVKAMEFGDVLRSVCQKLTDNQYHYFLRRLRLHLTPNIHWKYFLENFSTFQDETADDWAENMPKAPPPMSPKETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFLSKLSIERVPSPPMAAGDSGESTMAQRGSSAPEFSQGTRSNLYSPPRDSRVGLKSRSHPCTPVGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLLKAKETSLMRRMRIQNADKMKEAGMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFLRAFLQ

Entity 21 Entity 21 polymer

Description description	Cilia and flagella-associated protein 77
Molecular weight formula_weight	32786.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R2

MPDPAKPGKDLTAWKKKKQPVHRTVSQICPPPRRPLTVVDIRTGMENERLGVVRDSMFQNPLIVKAELGKPRERSCSLPGINFNYGLYIRGLDGGVPEAIGHWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENMLYRELNDIRINDQEDRRQKEPPPIPPNMTFGIRSRPSTPFFDLLQHRYQQLWVQEQKATQQAIKMEKKQKVILGKLYETRSSQLRKYKPPVKLDALWHMPHFKKVASHLATFPTEADRQRALKAHKEEYAVRQGTLRMGNYTHP

Entity 22 Entity 22 polymer

Description description	Cilia- and flagella-associated protein 20
Molecular weight formula_weight	22781.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	XC,XD,XE

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Entity 23 Entity 23 polymer

Description description	Parkin coregulated gene protein homolog
Molecular weight formula_weight	27763.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	XJ,XK,XL

MPKRTKLLPQQTFQVHQPRSLVSEGFTVKAMMKNSVVRGPPVAGAFKERPAKPTTFRKCYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLSEMTFPYEFFARRGIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQIICVTLKVLQHLVVSSEMVGEALLPYYRQILPILNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGEDAFINIKYMVPTYESCLLN

Entity 24 Entity 24 polymer

Description description	Sperm acrosome-associated protein 9
Molecular weight formula_weight	19512.4 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	YI,YJ,YK,YL,YM,YN

MNEVKESLRSIEQKYKLFQQQQFTFIAALEHCRENAHDKIRPISSIEQVQSYMEHYCNNSTHRRILIMFMDICSELSKLCQHFEALHSGTPVTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLIPIVLDFMKEWIAHSEKLPRKVLQHGTT

Entity 25 Entity 25 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	123

▶

Resolution resolution	4.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	37018

In situ structure of axonemal doublet microtubules in mouse sperm with 16-nm repeat

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tektin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Detyrosinated tubulin alpha-3 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta-4B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin bundle-interacting protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EF-hand domain-containing protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EF-hand domain-containing family member C2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer