8i7r

In situ structure of axonemal doublet microtubules in mouse sperm with 48-nm repeat

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Meiosis-specific nuclear structural protein 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MNS1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–491； UniProt 1–491 Author chain B； PDBConstruct 1–491； UniProt 1–491

Tektin-1

OrganismNot specified

UniProt Q9DAJ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT1_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A1； PDBConstruct 1–418； UniProt 1–418 Author chain A2； PDBConstruct 1–418； UniProt 1–418 Author chain A3； PDBConstruct 1–418； UniProt 1–418 Author chain A4； PDBConstruct 1–418； UniProt 1–418

Tubulin beta-4B chain

OrganismNot specified

UniProt P68372

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB4B_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AB； PDBConstruct 1–427； UniProt 1–427 Author chain AD； PDBConstruct 1–427； UniProt 1–427 Author chain AF； PDBConstruct 1–427； UniProt 1–427 Author chain AH； PDBConstruct 1–427； UniProt 1–427 Author chain AJ； PDBConstruct 1–427； UniProt 1–427 Author chain AL； PDBConstruct 1–427； UniProt 1–427 Author chain BB； PDBConstruct 1–427； UniProt 1–427 Author chain BD； PDBConstruct 1–427； UniProt 1–427 Author chain BF； PDBConstruct 1–427； UniProt 1–427 Author chain BH； PDBConstruct 1–427； UniProt 1–427 Author chain BJ； PDBConstruct 1–427； UniProt 1–427 Author chain BL； PDBConstruct 1–427； UniProt 1–427 Author chain CB； PDBConstruct 1–427； UniProt 1–427 Author chain CD； PDBConstruct 1–427； UniProt 1–427 Author chain CF； PDBConstruct 1–427； UniProt 1–427 Author chain CH； PDBConstruct 1–427； UniProt 1–427 Author chain CJ； PDBConstruct 1–427； UniProt 1–427 Author chain CL； PDBConstruct 1–427； UniProt 1–427 Author chain DB； PDBConstruct 1–427； UniProt 1–427 Author chain DD； PDBConstruct 1–427； UniProt 1–427 Author chain DF； PDBConstruct 1–427； UniProt 1–427 Author chain DH； PDBConstruct 1–427； UniProt 1–427 Author chain DJ； PDBConstruct 1–427； UniProt 1–427 Author chain DL； PDBConstruct 1–427； UniProt 1–427 Author chain EB； PDBConstruct 1–427； UniProt 1–427 Author chain ED； PDBConstruct 1–427； UniProt 1–427 Author chain EF； PDBConstruct 1–427； UniProt 1–427 Author chain EH； PDBConstruct 1–427； UniProt 1–427 Author chain EJ； PDBConstruct 1–427； UniProt 1–427 Author chain EL； PDBConstruct 1–427； UniProt 1–427 Author chain FB； PDBConstruct 1–427； UniProt 1–427 Author chain FD； PDBConstruct 1–427； UniProt 1–427 Author chain FF； PDBConstruct 1–427； UniProt 1–427 Author chain FH； PDBConstruct 1–427； UniProt 1–427 Author chain FJ； PDBConstruct 1–427； UniProt 1–427 Author chain FL； PDBConstruct 1–427； UniProt 1–427 Author chain GB； PDBConstruct 1–427； UniProt 1–427 Author chain GD； PDBConstruct 1–427； UniProt 1–427 Author chain GF； PDBConstruct 1–427； UniProt 1–427 Author chain GH； PDBConstruct 1–427； UniProt 1–427 Author chain GJ； PDBConstruct 1–427； UniProt 1–427 Author chain GL； PDBConstruct 1–427； UniProt 1–427 Author chain HB； PDBConstruct 1–427； UniProt 1–427 Author chain HD； PDBConstruct 1–427； UniProt 1–427 Author chain HF； PDBConstruct 1–427； UniProt 1–427 Author chain HH； PDBConstruct 1–427； UniProt 1–427 Author chain HJ； PDBConstruct 1–427； UniProt 1–427 Author chain HL； PDBConstruct 1–427； UniProt 1–427 Author chain IB； PDBConstruct 1–427； UniProt 1–427 Author chain ID； PDBConstruct 1–427； UniProt 1–427 Author chain IF； PDBConstruct 1–427； UniProt 1–427 Author chain IH； PDBConstruct 1–427； UniProt 1–427 Author chain IJ； PDBConstruct 1–427； UniProt 1–427 Author chain IL； PDBConstruct 1–427； UniProt 1–427 Author chain JB； PDBConstruct 1–427； UniProt 1–427 Author chain JD； PDBConstruct 1–427； UniProt 1–427 Author chain JF； PDBConstruct 1–427； UniProt 1–427 Author chain JH； PDBConstruct 1–427； UniProt 1–427 Author chain JJ； PDBConstruct 1–427； UniProt 1–427 Author chain JL； PDBConstruct 1–427； UniProt 1–427 Author chain KB； PDBConstruct 1–427； UniProt 1–427 Author chain KD； PDBConstruct 1–427； UniProt 1–427 Author chain KF； PDBConstruct 1–427； UniProt 1–427 Author chain KH； PDBConstruct 1–427； UniProt 1–427 Author chain KJ； PDBConstruct 1–427； UniProt 1–427 Author chain KL； PDBConstruct 1–427； UniProt 1–427 Author chain LB； PDBConstruct 1–427； UniProt 1–427 Author chain LD； PDBConstruct 1–427； UniProt 1–427 Author chain LF； PDBConstruct 1–427； UniProt 1–427 Author chain LH； PDBConstruct 1–427； UniProt 1–427 Author chain LJ； PDBConstruct 1–427； UniProt 1–427 Author chain LL； PDBConstruct 1–427； UniProt 1–427 Author chain MB； PDBConstruct 1–427； UniProt 1–427 Author chain MD； PDBConstruct 1–427； UniProt 1–427 Author chain MF； PDBConstruct 1–427； UniProt 1–427 Author chain MH； PDBConstruct 1–427； UniProt 1–427 Author chain MJ； PDBConstruct 1–427； UniProt 1–427 Author chain ML； PDBConstruct 1–427； UniProt 1–427 Author chain NB； PDBConstruct 1–427； UniProt 1–427 Author chain ND； PDBConstruct 1–427； UniProt 1–427 Author chain NF； PDBConstruct 1–427； UniProt 1–427 Author chain NH； PDBConstruct 1–427； UniProt 1–427 Author chain NJ； PDBConstruct 1–427； UniProt 1–427 Author chain NL； PDBConstruct 1–427； UniProt 1–427 Author chain OB； PDBConstruct 1–427； UniProt 1–427 Author chain OD； PDBConstruct 1–427； UniProt 1–427 Author chain OF； PDBConstruct 1–427； UniProt 1–427 Author chain OH； PDBConstruct 1–427； UniProt 1–427 Author chain OJ； PDBConstruct 1–427； UniProt 1–427 Author chain OL； PDBConstruct 1–427； UniProt 1–427 Author chain PB； PDBConstruct 1–427； UniProt 1–427 Author chain PD； PDBConstruct 1–427； UniProt 1–427 Author chain PF； PDBConstruct 1–427； UniProt 1–427 Author chain PH； PDBConstruct 1–427； UniProt 1–427 Author chain PJ； PDBConstruct 1–427； UniProt 1–427 Author chain PL； PDBConstruct 1–427； UniProt 1–427 Author chain QB； PDBConstruct 1–427； UniProt 1–427 Author chain QD； PDBConstruct 1–427； UniProt 1–427 Author chain QF； PDBConstruct 1–427； UniProt 1–427 Author chain QH； PDBConstruct 1–427； UniProt 1–427 Author chain QJ； PDBConstruct 1–427； UniProt 1–427 Author chain QL； PDBConstruct 1–427； UniProt 1–427 Author chain RB； PDBConstruct 1–427； UniProt 1–427 Author chain RD； PDBConstruct 1–427； UniProt 1–427 Author chain RF； PDBConstruct 1–427； UniProt 1–427 Author chain RH； PDBConstruct 1–427； UniProt 1–427 Author chain RJ； PDBConstruct 1–427； UniProt 1–427 Author chain RL； PDBConstruct 1–427； UniProt 1–427 Author chain SB； PDBConstruct 1–427； UniProt 1–427 Author chain SD； PDBConstruct 1–427； UniProt 1–427 Author chain SF； PDBConstruct 1–427； UniProt 1–427 Author chain SH； PDBConstruct 1–427； UniProt 1–427 Author chain SJ； PDBConstruct 1–427； UniProt 1–427 Author chain SL； PDBConstruct 1–427； UniProt 1–427 Author chain TB； PDBConstruct 1–427； UniProt 1–427 Author chain TD； PDBConstruct 1–427； UniProt 1–427 Author chain TF； PDBConstruct 1–427； UniProt 1–427 Author chain TH； PDBConstruct 1–427； UniProt 1–427 Author chain TJ； PDBConstruct 1–427； UniProt 1–427 Author chain TL； PDBConstruct 1–427； UniProt 1–427 Author chain TN； PDBConstruct 1–427； UniProt 1–427 Author chain UB； PDBConstruct 1–427； UniProt 1–427 Author chain UD； PDBConstruct 1–427； UniProt 1–427 Author chain UF； PDBConstruct 1–427； UniProt 1–427 Author chain UH； PDBConstruct 1–427； UniProt 1–427 Author chain UJ； PDBConstruct 1–427； UniProt 1–427 Author chain UL； PDBConstruct 1–427； UniProt 1–427 Author chain VB； PDBConstruct 1–427； UniProt 1–427 Author chain VD； PDBConstruct 1–427； UniProt 1–427 Author chain VF； PDBConstruct 1–427； UniProt 1–427 Author chain VH； PDBConstruct 1–427； UniProt 1–427 Author chain VJ； PDBConstruct 1–427； UniProt 1–427 Author chain VL； PDBConstruct 1–427； UniProt 1–427 Author chain WB； PDBConstruct 1–427； UniProt 1–427 Author chain WD； PDBConstruct 1–427； UniProt 1–427 Author chain WF； PDBConstruct 1–427； UniProt 1–427 Author chain WH； PDBConstruct 1–427； UniProt 1–427 Author chain WJ； PDBConstruct 1–427； UniProt 1–427 Author chain WL； PDBConstruct 1–427； UniProt 1–427

Detyrosinated tubulin alpha-3 chain

OrganismNot specified

UniProt P05214

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA3_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AC； PDBConstruct 1–438； UniProt 1–438 Author chain AE； PDBConstruct 1–438； UniProt 1–438 Author chain AG； PDBConstruct 1–438； UniProt 1–438 Author chain AI； PDBConstruct 1–438； UniProt 1–438 Author chain AK； PDBConstruct 1–438； UniProt 1–438 Author chain AM； PDBConstruct 1–438； UniProt 1–438 Author chain BC； PDBConstruct 1–438； UniProt 1–438 Author chain BE； PDBConstruct 1–438； UniProt 1–438 Author chain BG； PDBConstruct 1–438； UniProt 1–438 Author chain BI； PDBConstruct 1–438； UniProt 1–438 Author chain BK； PDBConstruct 1–438； UniProt 1–438 Author chain BM； PDBConstruct 1–438； UniProt 1–438 Author chain CC； PDBConstruct 1–438； UniProt 1–438 Author chain CE； PDBConstruct 1–438； UniProt 1–438 Author chain CG； PDBConstruct 1–438； UniProt 1–438 Author chain CI； PDBConstruct 1–438； UniProt 1–438 Author chain CK； PDBConstruct 1–438； UniProt 1–438 Author chain CM； PDBConstruct 1–438； UniProt 1–438 Author chain DA； PDBConstruct 1–438； UniProt 1–438 Author chain DC； PDBConstruct 1–438； UniProt 1–438 Author chain DE； PDBConstruct 1–438； UniProt 1–438 Author chain DG； PDBConstruct 1–438； UniProt 1–438 Author chain DI； PDBConstruct 1–438； UniProt 1–438 Author chain DK； PDBConstruct 1–438； UniProt 1–438 Author chain EA； PDBConstruct 1–438； UniProt 1–438 Author chain EC； PDBConstruct 1–438； UniProt 1–438 Author chain EE； PDBConstruct 1–438； UniProt 1–438 Author chain EG； PDBConstruct 1–438； UniProt 1–438 Author chain EI； PDBConstruct 1–438； UniProt 1–438 Author chain EK； PDBConstruct 1–438； UniProt 1–438 Author chain FA； PDBConstruct 1–438； UniProt 1–438 Author chain FC； PDBConstruct 1–438； UniProt 1–438 Author chain FE； PDBConstruct 1–438； UniProt 1–438 Author chain FG； PDBConstruct 1–438； UniProt 1–438 Author chain FI； PDBConstruct 1–438； UniProt 1–438 Author chain FK； PDBConstruct 1–438； UniProt 1–438 Author chain GA； PDBConstruct 1–438； UniProt 1–438 Author chain GC； PDBConstruct 1–438； UniProt 1–438 Author chain GE； PDBConstruct 1–438； UniProt 1–438 Author chain GG； PDBConstruct 1–438； UniProt 1–438 Author chain GI； PDBConstruct 1–438； UniProt 1–438 Author chain GK； PDBConstruct 1–438； UniProt 1–438 Author chain HA； PDBConstruct 1–438； UniProt 1–438 Author chain HC； PDBConstruct 1–438； UniProt 1–438 Author chain HE； PDBConstruct 1–438； UniProt 1–438 Author chain HG； PDBConstruct 1–438； UniProt 1–438 Author chain HI； PDBConstruct 1–438； UniProt 1–438 Author chain HK； PDBConstruct 1–438； UniProt 1–438 Author chain IA； PDBConstruct 1–438； UniProt 1–438 Author chain IC； PDBConstruct 1–438； UniProt 1–438 Author chain IE； PDBConstruct 1–438； UniProt 1–438 Author chain IG； PDBConstruct 1–438； UniProt 1–438 Author chain II； PDBConstruct 1–438； UniProt 1–438 Author chain IK； PDBConstruct 1–438； UniProt 1–438 Author chain IM； PDBConstruct 1–438； UniProt 1–438 Author chain JA； PDBConstruct 1–438； UniProt 1–438 Author chain JC； PDBConstruct 1–438； UniProt 1–438 Author chain JE； PDBConstruct 1–438； UniProt 1–438 Author chain JG； PDBConstruct 1–438； UniProt 1–438 Author chain JI； PDBConstruct 1–438； UniProt 1–438 Author chain JK； PDBConstruct 1–438； UniProt 1–438 Author chain KA； PDBConstruct 1–438； UniProt 1–438 Author chain KC； PDBConstruct 1–438； UniProt 1–438 Author chain KE； PDBConstruct 1–438； UniProt 1–438 Author chain KG； PDBConstruct 1–438； UniProt 1–438 Author chain KI； PDBConstruct 1–438； UniProt 1–438 Author chain KK； PDBConstruct 1–438； UniProt 1–438 Author chain LA； PDBConstruct 1–438； UniProt 1–438 Author chain LC； PDBConstruct 1–438； UniProt 1–438 Author chain LE； PDBConstruct 1–438； UniProt 1–438 Author chain LG； PDBConstruct 1–438； UniProt 1–438 Author chain LI； PDBConstruct 1–438； UniProt 1–438 Author chain LK； PDBConstruct 1–438； UniProt 1–438 Author chain MC； PDBConstruct 1–438； UniProt 1–438 Author chain ME； PDBConstruct 1–438； UniProt 1–438 Author chain MG； PDBConstruct 1–438； UniProt 1–438 Author chain MI； PDBConstruct 1–438； UniProt 1–438 Author chain MK； PDBConstruct 1–438； UniProt 1–438 Author chain MM； PDBConstruct 1–438； UniProt 1–438 Author chain NA； PDBConstruct 1–438； UniProt 1–438 Author chain NC； PDBConstruct 1–438； UniProt 1–438 Author chain NE； PDBConstruct 1–438； UniProt 1–438 Author chain NG； PDBConstruct 1–438； UniProt 1–438 Author chain NI； PDBConstruct 1–438； UniProt 1–438 Author chain NK； PDBConstruct 1–438； UniProt 1–438 Author chain OA； PDBConstruct 1–438； UniProt 1–438 Author chain OC； PDBConstruct 1–438； UniProt 1–438 Author chain OE； PDBConstruct 1–438； UniProt 1–438 Author chain OG； PDBConstruct 1–438； UniProt 1–438 Author chain OI； PDBConstruct 1–438； UniProt 1–438 Author chain OK； PDBConstruct 1–438； UniProt 1–438 Author chain PA； PDBConstruct 1–438； UniProt 1–438 Author chain PC； PDBConstruct 1–438； UniProt 1–438 Author chain PE； PDBConstruct 1–438； UniProt 1–438 Author chain PG； PDBConstruct 1–438； UniProt 1–438 Author chain PI； PDBConstruct 1–438； UniProt 1–438 Author chain PK； PDBConstruct 1–438； UniProt 1–438 Author chain PM； PDBConstruct 1–438； UniProt 1–438 Author chain QC； PDBConstruct 1–438； UniProt 1–438 Author chain QE； PDBConstruct 1–438； UniProt 1–438 Author chain QG； PDBConstruct 1–438； UniProt 1–438 Author chain QI； PDBConstruct 1–438； UniProt 1–438 Author chain QK； PDBConstruct 1–438； UniProt 1–438 Author chain QM； PDBConstruct 1–438； UniProt 1–438 Author chain RC； PDBConstruct 1–438； UniProt 1–438 Author chain RE； PDBConstruct 1–438； UniProt 1–438 Author chain RG； PDBConstruct 1–438； UniProt 1–438 Author chain RI； PDBConstruct 1–438； UniProt 1–438 Author chain RK； PDBConstruct 1–438； UniProt 1–438 Author chain RM； PDBConstruct 1–438； UniProt 1–438 Author chain SC； PDBConstruct 1–438； UniProt 1–438 Author chain SE； PDBConstruct 1–438； UniProt 1–438 Author chain SG； PDBConstruct 1–438； UniProt 1–438 Author chain SI； PDBConstruct 1–438； UniProt 1–438 Author chain SK； PDBConstruct 1–438； UniProt 1–438 Author chain SM； PDBConstruct 1–438； UniProt 1–438 Author chain TC； PDBConstruct 1–438； UniProt 1–438 Author chain TE； PDBConstruct 1–438； UniProt 1–438 Author chain TG； PDBConstruct 1–438； UniProt 1–438 Author chain TI； PDBConstruct 1–438； UniProt 1–438 Author chain TK； PDBConstruct 1–438； UniProt 1–438 Author chain TM； PDBConstruct 1–438； UniProt 1–438 Author chain UA； PDBConstruct 1–438； UniProt 1–438 Author chain UC； PDBConstruct 1–438； UniProt 1–438 Author chain UE； PDBConstruct 1–438； UniProt 1–438 Author chain UG； PDBConstruct 1–438； UniProt 1–438 Author chain UI； PDBConstruct 1–438； UniProt 1–438 Author chain UK； PDBConstruct 1–438； UniProt 1–438 Author chain VA； PDBConstruct 1–438； UniProt 1–438 Author chain VC； PDBConstruct 1–438； UniProt 1–438 Author chain VE； PDBConstruct 1–438； UniProt 1–438 Author chain VG； PDBConstruct 1–438； UniProt 1–438 Author chain VI； PDBConstruct 1–438； UniProt 1–438 Author chain VK； PDBConstruct 1–438； UniProt 1–438 Author chain WA； PDBConstruct 1–438； UniProt 1–438 Author chain WC； PDBConstruct 1–438； UniProt 1–438 Author chain WE； PDBConstruct 1–438； UniProt 1–438 Author chain WG； PDBConstruct 1–438； UniProt 1–438 Author chain WI； PDBConstruct 1–438； UniProt 1–438 Author chain WK； PDBConstruct 1–438； UniProt 1–438

Tektin-2

OrganismNot specified

UniProt Q922G7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT2_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B1； PDBConstruct 1–430； UniProt 1–430 Author chain B2； PDBConstruct 1–430； UniProt 1–430 Author chain B3； PDBConstruct 1–430； UniProt 1–430 Author chain B4； PDBConstruct 1–430； UniProt 1–430 Author chain B5； PDBConstruct 1–430； UniProt 1–430 Author chain B6； PDBConstruct 1–430； UniProt 1–430 Author chain B7； PDBConstruct 1–430； UniProt 1–430 Author chain B8； PDBConstruct 1–430； UniProt 1–430 Author chain B9； PDBConstruct 1–430； UniProt 1–430

Nucleoside diphosphate kinase 7

OrganismNot specified

UniProt Q9QXL8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDK7_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain C； PDBConstruct 1–395； UniProt 1–395 Author chain D； PDBConstruct 1–395； UniProt 1–395

Tektin-3

OrganismNot specified

UniProt Q6X6Z7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT3_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain C1； PDBConstruct 1–490； UniProt 1–490 Author chain C2； PDBConstruct 1–490； UniProt 1–490 Author chain C3； PDBConstruct 1–490； UniProt 1–490 Author chain C4； PDBConstruct 1–490； UniProt 1–490 Author chain C5； PDBConstruct 1–490； UniProt 1–490 Author chain C6； PDBConstruct 1–490； UniProt 1–490 Author chain C7； PDBConstruct 1–490； UniProt 1–490 Author chain C8； PDBConstruct 1–490； UniProt 1–490 Author chain C9； PDBConstruct 1–490； UniProt 1–490 Author chain Ca； PDBConstruct 1–490； UniProt 1–490 Author chain Cb； PDBConstruct 1–490； UniProt 1–490 Author chain Cc； PDBConstruct 1–490； UniProt 1–490 Author chain Cd； PDBConstruct 1–490； UniProt 1–490

Tektin-4

OrganismNot specified

UniProt Q149S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT4_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain D1； PDBConstruct 1–447； UniProt 1–447 Author chain D2； PDBConstruct 1–447； UniProt 1–447 Author chain D3； PDBConstruct 1–447； UniProt 1–447 Author chain D4； PDBConstruct 1–447； UniProt 1–447 Author chain D5； PDBConstruct 1–447； UniProt 1–447 Author chain D6； PDBConstruct 1–447； UniProt 1–447 Author chain D7； PDBConstruct 1–447； UniProt 1–447 Author chain D8； PDBConstruct 1–447； UniProt 1–447 Author chain D9； PDBConstruct 1–447； UniProt 1–447 Author chain Da； PDBConstruct 1–447； UniProt 1–447

EF-hand domain-containing family member B

OrganismNot specified

UniProt Q8CDU5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHB_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain E； PDBConstruct 1–853； UniProt 1–853 Author chain F； PDBConstruct 1–853； UniProt 1–853

Tektin bundle-interacting protein 1

OrganismNot specified

UniProt A6H6Q4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TKTI1_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain E1； PDBConstruct 1–206； UniProt 1–206 Author chain E2； PDBConstruct 1–206； UniProt 1–206 Author chain E3； PDBConstruct 1–206； UniProt 1–206 Author chain E4； PDBConstruct 1–206； UniProt 1–206

Tektin-5

OrganismNot specified

UniProt G5E8A8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT5_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain F1； PDBConstruct 1–557； UniProt 1–557 Author chain F2； PDBConstruct 1–557； UniProt 1–557 Author chain F3； PDBConstruct 1–557； UniProt 1–557 Author chain F4； PDBConstruct 1–557； UniProt 1–557 Author chain F5； PDBConstruct 1–557； UniProt 1–557 Author chain F6； PDBConstruct 1–557； UniProt 1–557 Author chain F7； PDBConstruct 1–557； UniProt 1–557 Author chain F8； PDBConstruct 1–557； UniProt 1–557 Author chain F9； PDBConstruct 1–557； UniProt 1–557 Author chain Fa； PDBConstruct 1–557； UniProt 1–557 Author chain Fb； PDBConstruct 1–557； UniProt 1–557 Author chain Fc； PDBConstruct 1–557； UniProt 1–557 Author chain Fd； PDBConstruct 1–557； UniProt 1–557 Author chain Fe； PDBConstruct 1–557； UniProt 1–557 Author chain Ff； PDBConstruct 1–557； UniProt 1–557 Author chain Fg； PDBConstruct 1–557； UniProt 1–557 Author chain Fh； PDBConstruct 1–557； UniProt 1–557 Author chain Fi； PDBConstruct 1–557； UniProt 1–557 Author chain Fj； PDBConstruct 1–557； UniProt 1–557 Author chain Fk； PDBConstruct 1–557； UniProt 1–557 Author chain Fl； PDBConstruct 1–557； UniProt 1–557 Author chain Fm； PDBConstruct 1–557； UniProt 1–557

Cilia- and flagella-associated protein 53

OrganismNot specified

UniProt Q9D439

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA53_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain G； PDBConstruct 1–514； UniProt 1–514 Author chain H； PDBConstruct 1–514； UniProt 1–514

EF-hand domain-containing protein 1

OrganismNot specified

UniProt Q9D9T8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC1_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain G1； PDBConstruct 1–648； UniProt 1–648 Author chain G2； PDBConstruct 1–648； UniProt 1–648 Author chain G3； PDBConstruct 1–648； UniProt 1–648

EF-hand domain-containing family member C2

OrganismNot specified

UniProt Q9D485

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC2_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain G4； PDBConstruct 1–750； UniProt 1–750 Author chain G5； PDBConstruct 1–750； UniProt 1–750 Author chain G6； PDBConstruct 1–750； UniProt 1–750

Protein FAM166A

OrganismNot specified

UniProt Q9D4K5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F166A_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain H1； PDBConstruct 1–319； UniProt 1–319 Author chain H2； PDBConstruct 1–319； UniProt 1–319 Author chain H3； PDBConstruct 1–319； UniProt 1–319 Author chain H4； PDBConstruct 1–319； UniProt 1–319 Author chain H5； PDBConstruct 1–319； UniProt 1–319 Author chain H6； PDBConstruct 1–319； UniProt 1–319

Cilia- and flagella-associated protein 95

OrganismNot specified

UniProt Q9CQC3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA95_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain I； PDBConstruct 1–228； UniProt 1–228

Protein FAM166C

OrganismNot specified

UniProt Q9DAS2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F166C_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain I1； PDBConstruct 1–200； UniProt 1–200 Author chain I2； PDBConstruct 1–200； UniProt 1–200 Author chain I3； PDBConstruct 1–200； UniProt 1–200

Cilia- and flagella-associated protein 107

OrganismNot specified

UniProt Q4KKZ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF107_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain J； PDBConstruct 1–196； UniProt 1–196

Dual specificity phosphatase 21

OrganismNot specified

UniProt Q9D9D8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DUS21_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain J1； PDBConstruct 1–189； UniProt 1–189 Author chain J2； PDBConstruct 1–189； UniProt 1–189 Author chain J3； PDBConstruct 1–189； UniProt 1–189

Cilia- and flagella-associated protein 161

OrganismNot specified

UniProt Q6P8Y0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF161_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain K； PDBConstruct 1–303； UniProt 1–303 Author chain L； PDBConstruct 1–303； UniProt 1–303

Coiled-coil domain-containing protein 105

OrganismNot specified

UniProt Q9D4K7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CC105_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain K1； PDBConstruct 1–499； UniProt 1–499 Author chain K2； PDBConstruct 1–499； UniProt 1–499 Author chain K3； PDBConstruct 1–499； UniProt 1–499 Author chain K4； PDBConstruct 1–499； UniProt 1–499 Author chain K5； PDBConstruct 1–499； UniProt 1–499

Enkurin

OrganismNot specified

UniProt Q6SP97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ENKUR_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain L1； PDBConstruct 1–255； UniProt 1–255 Author chain L2； PDBConstruct 1–255； UniProt 1–255 Author chain L3； PDBConstruct 1–255； UniProt 1–255 Author chain L4； PDBConstruct 1–255； UniProt 1–255

Piercer of microtubule wall 1 protein

OrganismNot specified

UniProt Q5BN45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PIRC1_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain M； PDBConstruct 1–167； UniProt 1–167

Testis-expressed protein 43

OrganismNot specified

UniProt Q9D9I1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEX43_MOUSE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain M1； PDBConstruct 1–141； UniProt 1–141 Author chain M2； PDBConstruct 1–141； UniProt 1–141 Author chain M3； PDBConstruct 1–141； UniProt 1–141

Piercer of microtubule wall 2 protein

OrganismNot specified

UniProt V9GXK1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PIRC2_MOUSE
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain N； PDBConstruct 1–122； UniProt 1–122

Cilia- and flagella-associated protein 276

OrganismNot specified

UniProt Q9DAD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF276_MOUSE
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain N1； PDBConstruct 1–168； UniProt 1–168 Author chain N2； PDBConstruct 1–168； UniProt 1–168 Author chain N3； PDBConstruct 1–168； UniProt 1–168 Author chain N4； PDBConstruct 1–168； UniProt 1–168

RIB43A-like with coiled-coils protein 2

OrganismNot specified

UniProt Q9D4Q1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RIBC2_MOUSE
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain O； PDBConstruct 1–377； UniProt 1–377 Author chain P； PDBConstruct 1–377； UniProt 1–377 Author chain Q； PDBConstruct 1–377； UniProt 1–377 Author chain R； PDBConstruct 1–377； UniProt 1–377

Protein Flattop

OrganismNot specified

UniProt Q6P8X9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLTOP_MOUSE
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain O1； PDBConstruct 1–189； UniProt 1–189 Author chain O2； PDBConstruct 1–189； UniProt 1–189 Author chain O3； PDBConstruct 1–189； UniProt 1–189

Cilia- and flagella-associated protein 52

OrganismNot specified

UniProt Q5F201

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA52_MOUSE
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain P1； PDBConstruct 1–620； UniProt 1–620 Author chain P2； PDBConstruct 1–620； UniProt 1–620 Author chain P3； PDBConstruct 1–620； UniProt 1–620

EF-hand calcium-binding domain-containing protein 6

OrganismNot specified

UniProt Q6P1E8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFCB6_MOUSE
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain Q1； PDBConstruct 1–1516； UniProt 1–1516 Author chain Q2； PDBConstruct 1–1516； UniProt 1–1516 Author chain Q3； PDBConstruct 1–1516； UniProt 1–1516

Cilia and flagella-associated protein 77

OrganismNot specified

UniProt A0A087WRI3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A087WRI3_MOUSE
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain R1； PDBConstruct 1–283； UniProt 1–283 Author chain R2； PDBConstruct 1–283； UniProt 1–283 Author chain R3； PDBConstruct 1–283； UniProt 1–283

Sperm-associated antigen 8

OrganismNot specified

UniProt Q3V0Q6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAG8_MOUSE
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain S； PDBConstruct 1–470； UniProt 1–470 Author chain T； PDBConstruct 1–470； UniProt 1–470

Cilia- and flagella-associated protein 45

OrganismNot specified

UniProt Q9D9U9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA45_MOUSE
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain U； PDBConstruct 1–551； UniProt 1–551 Author chain V； PDBConstruct 1–551； UniProt 1–551 Author chain W； PDBConstruct 1–551； UniProt 1–551 Author chain X； PDBConstruct 1–551； UniProt 1–551

Cilia- and flagella-associated protein 20

OrganismNot specified

UniProt Q8BTU1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA20_MOUSE
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain XA； PDBConstruct 1–193； UniProt 1–193 Author chain XB； PDBConstruct 1–193； UniProt 1–193 Author chain XC； PDBConstruct 1–193； UniProt 1–193 Author chain XD； PDBConstruct 1–193； UniProt 1–193 Author chain XE； PDBConstruct 1–193； UniProt 1–193 Author chain XF； PDBConstruct 1–193； UniProt 1–193 Author chain XG； PDBConstruct 1–193； UniProt 1–193

Parkin coregulated gene protein homolog

OrganismNot specified

UniProt Q9DAK2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PACRG_MOUSE
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain XH； PDBConstruct 1–241； UniProt 1–241 Author chain XI； PDBConstruct 1–241； UniProt 1–241 Author chain XJ； PDBConstruct 1–241； UniProt 1–241 Author chain XK； PDBConstruct 1–241； UniProt 1–241 Author chain XL； PDBConstruct 1–241； UniProt 1–241 Author chain XM； PDBConstruct 1–241； UniProt 1–241

Cilia- and flagella-associated protein 210

OrganismNot specified

UniProt A0JLY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF210_MOUSE
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain Y； PDBConstruct 1–547； UniProt 1–547 Author chain Z； PDBConstruct 1–547； UniProt 1–547

Sperm acrosome-associated protein 9

OrganismNot specified

UniProt Q7TPM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SACA9_MOUSE
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain YA； PDBConstruct 1–168； UniProt 1–168 Author chain YB； PDBConstruct 1–168； UniProt 1–168 Author chain YC； PDBConstruct 1–168； UniProt 1–168 Author chain YD； PDBConstruct 1–168； UniProt 1–168 Author chain YE； PDBConstruct 1–168； UniProt 1–168 Author chain YF； PDBConstruct 1–168； UniProt 1–168 Author chain YG； PDBConstruct 1–168； UniProt 1–168 Author chain YH； PDBConstruct 1–168； UniProt 1–168 Author chain YI； PDBConstruct 1–168； UniProt 1–168 Author chain YJ； PDBConstruct 1–168； UniProt 1–168 Author chain YK； PDBConstruct 1–168； UniProt 1–168 Author chain YL； PDBConstruct 1–168； UniProt 1–168 Author chain YM； PDBConstruct 1–168； UniProt 1–168 Author chain YN； PDBConstruct 1–168； UniProt 1–168 Author chain YO； PDBConstruct 1–168； UniProt 1–168 Author chain YP； PDBConstruct 1–168； UniProt 1–168 Author chain YQ； PDBConstruct 1–168； UniProt 1–168 Author chain YR； PDBConstruct 1–168； UniProt 1–168 Author chain YS； PDBConstruct 1–168； UniProt 1–168 Author chain YT； PDBConstruct 1–168； UniProt 1–168 Author chain YU； PDBConstruct 1–168； UniProt 1–168 Author chain YV； PDBConstruct 1–168； UniProt 1–168 Author chain YW； PDBConstruct 1–168； UniProt 1–168

Cilia- and flagella-associated protein 141

OrganismNot specified

UniProt Q9D9D9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 450	Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-1 × 4 （Q9DAJ2） Tubulin beta-4B chain × 139 （P68372） Detyrosinated tubulin alpha-3 chain × 140 （P05214） Tektin-2 × 9 （Q922G7） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Tektin-3 × 13 （Q6X6Z7） Tektin-4 × 10 （Q149S1） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Tektin-5 × 22 （G5E8A8） Cilia- and flagella-associated protein 53 × 2 （Q9D439） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 3 （Q9D485） Protein FAM166A × 6 （Q9D4K5） Cilia- and flagella-associated protein 95 × 1 （Q9CQC3） Protein FAM166C × 3 （Q9DAS2） Cilia- and flagella-associated protein 107 × 1 （Q4KKZ1） Dual specificity phosphatase 21 × 3 （Q9D9D8） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Enkurin × 4 （Q6SP97） Piercer of microtubule wall 1 protein × 1 （Q5BN45） Testis-expressed protein 43 × 3 （Q9D9I1） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 276 × 4 （Q9DAD0） RIB43A-like with coiled-coils protein 2 × 4 （Q9D4Q1） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） EF-hand calcium-binding domain-containing protein 6 × 3 （Q6P1E8） Cilia and flagella-associated protein 77 × 3 （A0A087WRI3） Sperm-associated antigen 8 × 2 （Q3V0Q6） Cilia- and flagella-associated protein 45 × 4 （Q9D9U9） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 6 （Q9DAK2） Cilia- and flagella-associated protein 210 × 2 （A0JLY1） Sperm acrosome-associated protein 9 × 23 （Q7TPM5） GUANOSINE-5'-TRIPHOSPHATE × 279	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CP141_MOUSE
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain a； PDBConstruct 1–101； UniProt 1–101

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8i7r
Deposition date deposition_date	2023-02-02
Structure title title	In situ structure of axonemal doublet microtubules in mouse sperm with 48-nm repeat
Keywords keywords	microtubules, axoneme, sperm, filament, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8i7r__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8i7r__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8i7r__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	210.60 Å
Total Rg	210.50 Å
Atom count	1283344
Residues	160892
Excluded volume	22671000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8i7r__assembly_1__model_1`	450-meric （450）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (39)

Entity 1 Entity 1 polymer

Description description	Meiosis-specific nuclear structural protein 1
Molecular weight formula_weight	60353.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1283344

MATKKRALSFSEKHQKLVDEKFRKSLNIQVMNKLERQAKNQVVQNENDEKVERQRFLRVLQNEQFELDMEEAIQKAEANKMLRDRQLEQEERLANELARLKHESLKDKKMRQQVRENSIELRELEQKLKAAYMNKERAAQIVEKDAMKYEQMKRDAEIERIMMEEHDRLLKEESAKQERRNKERAQYYLDLEKQLEDQERRKQEAYEQLLKEKLMIDEIVRKIYEEDQVERQQKLEKKNAIQKYIEEFQRAQDFWRQKKREEMEEENRKIIEFANIQEQREGERMARVHEIEEKRVQRQNLLMKQLEETLRQRDDLEQVRQELYQEEQAEIIKLKVKEEAELRLRRQREMKQDFEDQMALKELILQAAKEEEETFKKAMLAKFAEDDRIELMNAQKQRMKQLEHKRAVEKLIEERRSQFLADKQRELEELQLQQRRQGCINEIIEEERLRLLKEHAAKLLGYLPKGVFKREDDVDMLGEEFRKAYQKRDGV

Entity 2 Entity 2 polymer

Description description	Tektin-1
Molecular weight formula_weight	48713.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,A2,A3,A4

MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIPPRDGDDHGAWEGGIRAEAIC

Entity 3 Entity 3 polymer

Description description	Tubulin beta-4B chain
Molecular weight formula_weight	47897.9 kDa
Source method src_method	nat
Copy count entity_count	139

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;AB,AD,AF,AH,AJ,AL,BB,BD,BF,BH,BJ,BL,CB,CD,CF,CH,CJ,CL,DB,DD,DF,DH,DJ,DL,EB,ED,EF,EH,EJ,EL,FB,FD,FF,FH,FJ,FL,GB,GD,GF,GH,GJ,GL,HB,HD,HF,HH,HJ,HL,IB,ID,IF,IH,IJ,IL,JB,JD,JF,JH,JJ,JL,KB,KD,KF,KH,KJ,KL,LB,LD,LF,LH,LJ,LL,MB,MD,MF,MH,MJ,ML,NB,ND,NF,NH,NJ,NL,OB,OD,OF,OH,OJ,OL,PB,PD,PF,PH,PJ,PL,QB,QD,QF,QH,QJ,QL,RB,RD,RF,RH,RJ,RL,SB,SD,SF,SH,SJ,SL,TB,TD,TF,TH,TJ,TL,TN,UB,UD,UF,UH,UJ,UL,VB,VD,VF,VH,VJ,VL,WB,WD,WF,WH,WJ,WL ;

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQD

Entity 4 Entity 4 polymer

Description description	Detyrosinated tubulin alpha-3 chain
Molecular weight formula_weight	48689.1 kDa
Source method src_method	nat
Copy count entity_count	140

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;AC,AE,AG,AI,AK,AM,BC,BE,BG,BI,BK,BM,CC,CE,CG,CI,CK,CM,DA,DC,DE,DG,DI,DK,EA,EC,EE,EG,EI,EK,FA,FC,FE,FG,FI,FK,GA,GC,GE,GG,GI,GK,HA,HC,HE,HG,HI,HK,IA,IC,IE,IG,II,IK,IM,JA,JC,JE,JG,JI,JK,KA,KC,KE,KG,KI,KK,LA,LC,LE,LG,LI,LK,MC,ME,MG,MI,MK,MM,NA,NC,NE,NG,NI,NK,OA,OC,OE,OG,OI,OK,PA,PC,PE,PG,PI,PK,PM,QC,QE,QG,QI,QK,QM,RC,RE,RG,RI,RK,RM,SC,SE,SG,SI,SK,SM,TC,TE,TG,TI,TK,TM,UA,UC,UE,UG,UI,UK,VA,VC,VE,VG,VI,VK,WA,WC,WE,WG,WI,WK ;

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD

Entity 5 Entity 5 polymer

Description description	Tektin-2
Molecular weight formula_weight	50385.1 kDa
Source method src_method	nat
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B1,B2,B3,B4,B5,B6,B7,B8,B9

MATLSFKPSERYRLSDWRTNSYLLSTNAERQRDASHQIRQEARILRNETNNQIVWDEHDNRTRLAERIDTVNRWKETLDKCLTDLDAEIDSLAQAKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVRDPVEEELLKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTSPNISLKVNPTRIPKDSTTLQQWDEFTRFNKNRAEAEMKASIELREAIALAIAQTNNELDAQRVATEFTFRKRLREMESFYSELKWQEKNTLEEIAELQGDIRRLEEDLRRKMMNLKLAHTRLESRTYRSNVELCRDQTQYGLIDEVHQLEATINTMKQKLAQTQNALDALFKHLARIQADIACKTNTLLLDTKCMDTRRKLTVPAEKFVPQVDTFTRTTNRTLSPLKICQLELT

Entity 6 Entity 6 polymer

Description description	Nucleoside diphosphate kinase 7
Molecular weight formula_weight	44489.8 kDa
EC 编号 ec_number	2.7.4.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MRACQQGRSSSLVSPYMAPKNQSERFAFIAEWYDPNASLLRRYELLFYPVDGSVEMHDVKNRRTFLKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAISEGMLGKNLIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTDLPEDGLLEVQYFFKILDN

Entity 7 Entity 7 polymer

Description description	Tektin-3
Molecular weight formula_weight	56754.8 kDa
Source method src_method	nat
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C1,C2,C3,C4,C5,C6,C7,C8,C9,Ca,Cb,Cc,Cd

MELLGSTLTATYAHPPPASASFLPAIGTITSSYKDRFPHRNLTHSLSLPWRPNTYYKTAYNYPTLAPYSSRSQRVCESTMLPFVSNRTTFFTRYTPDDWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSYPSTLRLVGYC

Entity 8 Entity 8 polymer

Description description	Tektin-4
Molecular weight formula_weight	52121.4 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D1,D2,D3,D4,D5,D6,D7,D8,D9,Da

MAQTGVLLTKEPAPQSIDVCELPRKEYEVACNTGAYTSSGLATAGFRTAKYLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRYPSVLQLAGYQ

Entity 9 Entity 9 polymer

Description description	EF-hand domain-containing family member B
Molecular weight formula_weight	95892.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MCSFVRVGSPKPLQTSASPLEMSSLRRTRAPEISELGLTPEQKDDIRDRVLRGSKSPTELGFDLRLEQDRKWRERMGSSEAKSPPCHALGVGLERHTISGTPTEMGNLGLHKGSAFQGSKPLGVLPGRVGPENKGLPPRLRYGGTLHPPFSTVHASPLAAESRRRPLAWGSAWTDAVVEKQPVVGLELRKEPEKEPTCVVMNPYPEMPPKEVDIGLPQTQESDEAKNTEPLIGLVREPSECPFAQQPEEKKEPGSTEPGVEPPGNIRPIYSGKFFDRVPCWPSAGKVKPVGYRVATCLTEKLPRLMTPPEAKKYFNFRYPPAGAERVFYGRANDPQIAPYLTHGLRSKISIPMGSLINPQPITTFQQKIKDKKESIYFSHQRAPLGKSHDQTPGLPKGMDVINTTLGTPTIRELSVRDTVNPSKSFEDVLKEGQEGHDLYTVSHNDYFAGEAKNRKYNPASFHRFNLYGIPTPHFNDGRTMAKALHWLHELQMERGAKIVSKRVDDFKEKFQHKLGKVLDPIAETMNVPPGHTFGSCLHPEEYGAGDLIHYRSPDEYLRGKDHQRAVVAAARHHLKKFNHQNFDTLQVAFRHYDKKGDGVIDRAELHEACVQANLHLDKMLLDHLFDYCDVDQDGLINYLEFANFLNWKDRIPLKEHEKRVVVKGKKPDCENVTDTSMGEAEPSLLINPEDIVPKEPGSSEETLRTIQRPGDKVSHQYKTTSSEINAVVGAVPSMCHPIFGVPTIRSDISAPRIRRVSDMNNYGDEGNAYSLLHPSIFSQKGVFERDFFKTRSKEEISDILTNIGVKLSKEEFENVWNLASKKHQRGEVCVETIRNVLDELLHADLVKCKTAM

Entity 10 Entity 10 polymer

Description description	Tektin bundle-interacting protein 1
Molecular weight formula_weight	23987.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E1,E2,E3,E4

MENVRREATRPSVPSGTLELYFPDHLYRNDYVSLEGPRWAPAIKQAVRWKFTPMGRDAAGQVWFTGLTNSEPGDAWYKLPRALDTPYREAHTRWHGCFQSRQRGLPPAYTQHLREMAFWDPAITAQYLNSGPRWGCMQWRDRQIRGKEFVVTRNQFGAKLPWRSDYVPLLSLPQRPRFTAQDFRQRGLQRPCPAIGQPPPAFTPAL

Entity 11 Entity 11 polymer

Description description	Tektin-5
Molecular weight formula_weight	62817.5 kDa
Source method src_method	nat
Copy count entity_count	22

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F1,F2,F3,F4,F5,F6,F7,F8,F9,Fa,Fb,Fc,Fd,Fe,Ff,Fg,Fh,Fi,Fj,Fk,Fl,Fm

MEFLGTTQTASFCGPKKGCGLQALPPAGQEPVVQECYQPFHLPGYRYLNAWRPSVFHKIATSQTIPEECSGIRRPPTILPSLRSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFRLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKSRLEHELAIKANTLCIDKDKCMSMRKSFPSTPRLTGYTCSAIGSGPYANHAPRISSGPCSGSALCKGPASCGGGASCGGGASCGGHAPCGSALCSHSVSRSGPGFAPVC

Entity 12 Entity 12 polymer

Description description	Cilia- and flagella-associated protein 53
Molecular weight formula_weight	62036.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H

MYSQQFGTVPREFKGPTPKAVIIRAKPPKAQRAEQHLKRIQRSYHKYHTTLASIKSNEENRLKCDWIQRNNHKTFDSLVQARVQDAMQGFVINTEERRNKLRELLASEENEYFSEMQLKGETIEEKKDKMRERTKLLREKKEKERQEFVAEKLDQQFRERCEELRTKLASIHEKKVVEERNAQIEFNKELKRQKLVEEHLFARLWEEDRLAKERREAQEEKRQRELVQNTRLGLDAQVTSIQAQRQGARRMKEEEARILEQNKAQIKREDEQEKLQKQKRRQETRSSLKKAVQDKIESMQREYREDLDLNMKLVGRALQDLQDEADKKKQKREEMGREQKIYNDYLMQRREEEKAQEKELNRLLEDIKAKKLAEKDRELALQRAARKQLMNEVMNTRKLQVQERLQRKLREQEELALHEQRISESLKVLHQEDMEDFARRCALAEEYRNQLQMQIAHQQQAREAEKEEERQEFEAGLAANKACLDKIQRILSENQALSQNVHPMRRGYPDKPPL

Entity 13 Entity 13 polymer

Description description	EF-hand domain-containing protein 1
Molecular weight formula_weight	75235.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G1,G2,G3

MGTNPVHGLPFLPGSSFTDSTKTAFHRSQTLNYRNGYAVVRRPTMGIGGDRLHYNQLSQAELDELANKAPILTYGPLKQAPLAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDHYHWKDLNRGINLTVYGKTFRIVDCDRFTQDFLESQGIELNPSEKIPLDPYTQLRKEPVRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVLVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFGMPDLPPVDVTKKEPPPVKQELPPYNGYGLIEDSAQNCFALIPKAPRKDVVKMLMNDNKVLRYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVDNPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIQKPELPAPELESKQATGEPMVQGTEESKVQDLDALIDQIHMHLKYNSYKENLRETFQMYDKDESGYVDRETFFKICETLNVPVDDSLIKELIRLCTHGEGRINYYNFVRAFSN

Entity 14 Entity 14 polymer

Description description	EF-hand domain-containing family member C2
Molecular weight formula_weight	87758.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G4,G5,G6

MALPFLPGNSFNRNIGKERFHKSQHWGFCNNVRMLVSENKPGVGGDLLYGQKIKPKHSVFPKGDGTDAPSWVAFDKQVLSFDAYLEDEISDKRQEIFRIRYYKIYFYLEDDTIQVNEPEVINSGLPQGTSIRRQRIPYPPPNDDQFYTVYDFNINISVVFYGRTFKIYDCDPFTKNFLKKIGIKLNPPGQCPLDPYMKMRRETLEFVDPFRPYQSFDTLKRFIQYDGKVLRFFCLWDDSTSLFGDRREFVLHYFLCDGTVEIREVLPSNSGRDAMSSFLRRGKLPKYGPPGIYQPGQITDRAVLNVYGGLSEWRADGYLLDKYQLGKVEQDFYTDQDLSIGATINVWGRKVLLCDCDEFTKTYYRTKYGVDNFTPISCKPPHLPKIERKYPPYTGFGSEEDSFRSCVGLKPTPHRKNFKKFMELDSFGNISNILRYFGKLITHKCADVDRIFVIAFYLSDDTISVFEPIENNSGNAGGMFLKRSRVKKPGQEVFKSEFSEYIKAEELYIGATVNINGYLFILLNADEYTLNYMENNTDKFPYSNFELAIQKLKQEKSKSREITQVFAAADYNHTKVVPYNTFRDILMSITMGKLIDQELITIARHYRVPEIMDPDLAYLIARAHEKFKKNIFENFDMFIYNCVYEDREKKGVLPTKDIRRMCKSSRLPLDDDFLDCLLSRFEDKDHQINYEIFFSVLNWRMNPTPDLQAPPYLKEKCEDVWVGMPSPIPVKYVRYLDFLIDVYGLEDNML

Entity 15 Entity 15 polymer

Description description	Protein FAM166A
Molecular weight formula_weight	36659.6 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H1,H2,H3,H4,H5,H6

MTATQKHNLFTPEPHYIPGYAGFYPQLRYQVGNTYGRTTAQLLTDPSVQKSPCSVLSPMTKPKFIEDFSKSKPPWIPCRDLREPYIPHYTSLKPYKNFEILGQLPRQDVDTQGPPQVENRQGPLTAGFMPYPPYPACPPGRKGEARDLGHPGLLLAYGEEAWKDAAPLQDTPGKNNQLYHCRRDEYLPPHPPQETLDVGRFQRLPQLDHPNLIQRKAISGYAGFVPRFAWVMGMNYRDGVTQAMDDFDKNQFVFRHPVCALGERLPRTHWPNTTIYRSQGLIPFYMGFIPSMQDNYALTFGNSTRRAYQKELDRRSHTL

Entity 16 Entity 16 polymer

Description description	Cilia- and flagella-associated protein 95
Molecular weight formula_weight	26633.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MGTFDSQCHECFESKERWYEIGPTDLLERKGSLTLRSHHKKYSEPVLVYSWHRNREAFPKDYDIESLETVKNLCMSTYKRFGSDSPRWMSEAREQMAQVLVNKDLVEKKKTGLLDEETLCPGILERDPELPPTGFRDVPMESPPDPRKPCFSTTYSEDFTPQYEYPPPACPRREEYSIVHRKCRSQFTDLNGSKRLGINTWHDESGIYANSEAKQKLYALARNPIVPF

Entity 17 Entity 17 polymer

Description description	Protein FAM166C
Molecular weight formula_weight	23098.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I1,I2,I3

MAFRSAGTLMTEFNAAFVPPALMPGYKGHVPGVASSFGSSYGNTTFKYFQDLRNTGLEKSYALLSGGCFPTIFSPNSPLVLTDNSQNWDRWLHQPTYSRSNQDNGRTTELTNFYKTVQQQRKYYQDKTGILSRVPYFVLPVKEPDRYPLPTDLPPLSEKSKWNLLRLSPDYKRTYQTFPSGKRVSSQERQRRDLYFEFRA

Entity 18 Entity 18 polymer

Description description	Cilia- and flagella-associated protein 107
Molecular weight formula_weight	23062.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MAMLSTSVVPEAFSTPGWQIEKKYSTKVLLGNWVEERGKFTKAIDHTPQCIYRKEYVPMPDHRPDFVSRWYSKSKMEGLPYKHLITHHQEPSHRYLISTYDDHYNRHNYNPGLPALRTWNGQKLLWLPEKSDFPLVAPPTNYGLLEQLQQKWLASKTSLKESIYTTSYPRLPVCAMSRREHAIPVPHPRLQPIPRF

Entity 19 Entity 19 polymer

Description description	Dual specificity phosphatase 21
Molecular weight formula_weight	21527.6 kDa
EC 编号 ec_number	3.1.3.16,3.1.3.48
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J1,J2,J3

MTTASCIFPSQATQQDNIYGLSQITASLFISNSAVANDKLTLSNNHITTIINVSAEVVNTFFEDIQYVQVPVSDAPNSYLYDFFDPIADHIHGVEMRNGRTLLHCAAGVSRSATLCLAYLMKYHNMTLLDAHTWTKTCRPIIRPNNGFWEQLIHYEFKLFSRNTVRMIYSPIGLIPNIYEKEAYLMELM

Entity 20 Entity 20 polymer

Description description	Cilia- and flagella-associated protein 161
Molecular weight formula_weight	34433.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L

MAQNVYGPGVRMGNWNEDVYLEEERMRHFLEKREKGELLIQRNRRVKKNILRPMQLSVSEDGYVHYGDKVIIVNPDQVLGEEAGKFMRGDLSLCMSPDEVKAQLSDDLEIPCGVSAVQTIAPMGRNTFTILSDGANSCEMGQVVVYGQNFCLGIAAGLEGKMLYLTSDHRTLLKSSLKSGLQEVTLTDEVTHLNCWQAAFLDPQLRLEYEGFPVRANEKIVIYHRHTNRALAVHRNLFLRTYFGKEMEVVAHTYLDSHKVEKPKNQWMLVTGNPRNKSNTMLDISKPITEDTRALEQAMGINT

Entity 21 Entity 21 polymer

Description description	Coiled-coil domain-containing protein 105
Molecular weight formula_weight	57406.5 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K1,K2,K3,K4,K5

MPVLLPSTDPGQDSRVGAPEWRQAAKATSRKAHLLTDRCGQEAVTMWQPKDSVLDPNVAHHLGRAAYMEPWRFRVEMLKGGGTLEKPPPGEGVTLWKGKMKPPAWYARLPLPMHRDARAQQTAEVVHAHARGARLTAARLGRAQHQINGQLRLLLRQREATDRRLSEVRKGLLINQQSVKLRGYRPKCEKIPDKADSLLVWEKKELKSMKRKMEKDMEISEDLLKALASCRDTLDFYCQERLQAVELMNQPLDKVLEQAGRHSWVDITRPPTPRTQGLKTPPPDPIGTYTPACAKALFEAKRLLMESKDILTEMAKNEVDIQNQQQEISNRVCSSLAQKMRETLELKERMTMTLGLMRGTIHRCMKFNQEMYVTRGIIKGPLLKRNLEAREKLNRPLVRMYQRHVGTQLPEATRLAQGTDLLTRHNLHMEKNLKELRTTHDNLAWGLNCKKIGHDVDYDVVRLRLRQRHPHVCYEQAQRLVNDWDPPTPARSQTNTASK

Entity 22 Entity 22 polymer

Description description	Enkurin
Molecular weight formula_weight	29587.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L1,L2,L3,L4

MDSPCTSESIYNLIPSDLKEPPQHPRYTSLFRATIKNDMKKFKTAMKTMGPAKVEIPSPKDFLKKHSKEKTLPPKKKFNRCSPKKPAVPLRTDHPVMGIQSGKNFINTNAADVIMGVAKKPKPIYVDKRTGDKHDLETSGLFPKYINKKDYGITPEYICKRNEDVKKAQEEYDNYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSVPKKIRKQKLEKEMKQLEHDISVIEKHKIIYIANK

Entity 23 Entity 23 polymer

Description description	Piercer of microtubule wall 1 protein
Molecular weight formula_weight	18862.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSEEKPQQSAEEPEPGEPKAKPAPEEPEPGEPKAKPAPEEPEPGEPKAKPAPEKTSDYYRISEKLPVRFNNPGWFHGYGTKEAVSMYRTSNQTYGSRAPTVHEMPKVFYPSSNKFSRQHAAFGMFQSHNINVTLEKSLVTGPDNHITHYDRLNFHPSYNVNRPSICD

Entity 24 Entity 24 polymer

Description description	Testis-expressed protein 43
Molecular weight formula_weight	16305.6 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M1,M2,M3

MASEKDDGPALPKLDDDNQTAENTCKPAEEQPQQLRWDDIHLPRFSLKQGMIPTRYVMPWKENMKFRNVNLQQAEACGIYAGPLEDSLFWGYSERLCHGEDRKAVLKKGLPEIKITDMPLHSPLSRYQSTVISHGFRRRLI

Entity 25 Entity 25 polymer

Description description	Piercer of microtubule wall 2 protein
Molecular weight formula_weight	13728.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MARETDCDLDKKTSLTSDAEMRPEPPALCVNPGNPVFSCMLDPKTLHTATSLSKAQMIMYKTSASQYGAFSPRPFFFPCKFLPQEQAFTEHLKTTGFYQNNSLNVGPDRTRTIDSPNYQHTL

Entity 26 Entity 26 polymer

Description description	Cilia- and flagella-associated protein 276
Molecular weight formula_weight	18960.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N1,N2,N3,N4

MLQPQETFSNPALRDEDKHLGNLWASKKSLYKNPAHLAQQQDPWSRLSSTPTATSRSRDTFFDSKIPKDDLDFRLATLYNHHTGAFKNKTEILLHQETIEDIQGTKIQFPGECFHAPSAPITSRTTIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKNDGGFFST

Entity 27 Entity 27 polymer

Description description	RIB43A-like with coiled-coils protein 2
Molecular weight formula_weight	45328.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P,Q,R

MEVAMSKDLQQEANLAKKRYIDLCRQGRIFDARNRIIGGDTQAWDFQVRDQKIKEITDKARHEAFAAEMKHNDKVMCMAHDREQRHRKQLCRAINDFQQNFQKPETRREFDLSDPLALQKELPARISDNDMRNTISGMQKFMGEDLNFQERRRFQKEQSREWFLQQHGEREKARADHLLAEHLHTQTRLKFDETARELMKLEGSTRKEVCAAVKAFNKNQVVELTERKRQEKQQEQEDNMTEITNLLHGDLLSENPRPVASSFGSHRVVLDRWKGMNREQLEEIWFTQKRQIQEKLRLQEEERQHSMDWDLRRIRKAHASLLHERQQQRLLREQRRALDCSNLNLARQQYLQKKQMNTASSSQPTEDYFSQFNTRSR

Entity 28 Entity 28 polymer

Description description	Protein Flattop
Molecular weight formula_weight	20575.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O1,O2,O3

MATNYSANQYEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLKIPPAKVTLTARTTTAADNLTKWIHKNPDLLNACNGLRPEISGKPFDPDSQTKQKKSVTKTVQQAPNPTIIPSSPVIQGDNPDEPQSSHPSAGHTPGPQTPVNSPNNPPPSPCKSTK

Entity 29 Entity 29 polymer

Description description	Cilia- and flagella-associated protein 52
Molecular weight formula_weight	68322.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P1,P2,P3

MEEQVLPELDVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKVQLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFPFGTAELFATCAKKDIRVWHTMSKRELLRITVPNMTCHGIDFMRDGKSIISAWDDGKIRAFAPESGRLMYTINSAHRIGVTAIATTSDCKRIISGGGEGEVRVWQVGCQTQKLEEALKEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELEGSLSGSINGMDITQEGGHFVTGGHDHLVKVWDYNEGEVTHVGVGHSGNIMAMRISPGNQYIVSVSADGAILRWKYPFAS

Entity 30 Entity 30 polymer

Description description	EF-hand calcium-binding domain-containing protein 6
Molecular weight formula_weight	176028.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q1,Q2,Q3

MKRNGTRLNFAKANSTKSGSTRARDLMNKMSIIPEWHSLYSNTRKLPCSRPHSSPCKMQRTIFQDLCRPSSSTTAIANPVLSYLDIERILAQKISSRRDDIKKVFQILDRNHNQMVTKGDLKRVITAFLIPLTKDQFQDLLAQIPISSLGNVPYLEFLSRFGGGIDININGIKRVNENEVDNRRTVKEVQLTEKIFRNMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNLSVKNDASFKYLLSNAAELSRETQQGKNGKRLLDTGSSEDVWKNYSLDDLEKTFCQEFSKSYEKIEKALSAGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKTSTKINWKQFLTAIYERQKLEVSKTLPLKKRSSTEARNRSRKENIIKKLFKYSEDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFDPEGTGAVRVNSLLDVLDDSTKVRKMSPSTDTKTPLPVAWDSVEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQEAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERTQPSGEKTSEINNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVKINQEEFRKVLERSGMPMNDCQYAMLASKLGFKNEEGMSYQDFTMGFEDCMLSGLETVPLQSRTASRTNMDEHFISAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERFLSLLGLRLSVTLNFREFQNLCEKRPWKSDEAPQRLIRCKQKVADSELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLTPREFEKLWQNYDTEGRGYITYQEFLHRLGIRYSPKVHRPYKEDYFNFLGHFTKPKQVQEEIQELQQISEREKLMNHYEEISKAFNAMEKSKPVALCRVQKVLQECGCPLKEEELISLLKSLDVSVHNNHIDPVEFLRALEISWASKARPKEKEESSPPPISFSKVTPDEVIKTMQEVVESSQPALVEAFSALDKEDTGFVKAMEFGDVLRSVCQKLTDNQYHYFLRRLRLHLTPNIHWKYFLENFSTFQDETADDWAENMPKAPPPMSPKETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFLSKLSIERVPSPPMAAGDSGESTMAQRGSSAPEFSQGTRSNLYSPPRDSRVGLKSRSHPCTPVGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLLKAKETSLMRRMRIQNADKMKEAGMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFLRAFLQ

Entity 31 Entity 31 polymer

Description description	Cilia and flagella-associated protein 77
Molecular weight formula_weight	32786.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R1,R2,R3

MPDPAKPGKDLTAWKKKKQPVHRTVSQICPPPRRPLTVVDIRTGMENERLGVVRDSMFQNPLIVKAELGKPRERSCSLPGINFNYGLYIRGLDGGVPEAIGHWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENMLYRELNDIRINDQEDRRQKEPPPIPPNMTFGIRSRPSTPFFDLLQHRYQQLWVQEQKATQQAIKMEKKQKVILGKLYETRSSQLRKYKPPVKLDALWHMPHFKKVASHLATFPTEADRQRALKAHKEEYAVRQGTLRMGNYTHP

Entity 32 Entity 32 polymer

Description description	Sperm-associated antigen 8
Molecular weight formula_weight	50591.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T

METTESTEGSLSRSCDVQPSSERLDTPSEPVPSSSSSPRSTAPAEAPAQYSVLTEPSSDSLYGAPCPPAHHRGHGFGFQPFYVSCIPQDPCNMADLSSRADPTSSYPCHSSVHGSGSGTCGLGQSSEPSQGSGPTSGPAPASVPSLVSGPDSASGPDSSASGPALASGPGPADPGQGPKFSTCIPQGYRCIPVDLAPDYNAWCQHLHWKPQRSWEPLQVSEPGVRGPYKPPEPGALGPCEPCEPCEPPEAESEETLCKARPRGQCLLYNWEEERATNQLDQIPPLQDGSESYFFRHGHQGLLTTQPQSPMSSSTTQRDSYQLPRHICQPLRGKREAMLEMLLRHQICKEVQAEQEPARKLFETESVTHHDYRVELVRAAPPASTKPHDYRQEQPETFWIQRAARLPGVSDIRTLDTPFRKNCSFSTPVPLSLGQPLPYELESGPHQVGVISSLACQGGGQGCGRTKTTPI

Entity 33 Entity 33 polymer

Description description	Cilia- and flagella-associated protein 45
Molecular weight formula_weight	65962.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V,W,X

MPLRPGDASSSASTASNRSRTRTRYRTKAMNSEVDESLFGGVKPSSQGKSDSPIVVIHDKHAIRKTLSALGLEHKTETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASQVLTKEELNAREQALKKEKEGILEAVTIRKKIMKQKEMTWNNNKKLSDLEEVARERAQNLLQRADKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDEEERRLDHMMEIDRRESLQRQEDRERKRREERVRGKRHIVEQIKKNEEERSLQAEHREQEKEQMLAYLDRLQEEDLQDLERRHQEKLKMQAEIKRINDENQRQKAEMLAQERLADQMVMEFTKKKMAREAEYEAEQEKIRREKEKEIARLRALQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENAQKKIETEEKLRKSRLEQVAFKEHTLAVQVQRDRDEFERILRAQREQIEREKQEQEKKAKGCLQHANELRRQVRENQQKHVQNRLATFEEGRRLKEEAEKRRERIEDIKKQKLEELRATGLPEKYCIEVERKANILPATSVN

Entity 34 Entity 34 polymer

Description description	Cilia- and flagella-associated protein 20
Molecular weight formula_weight	22781.4 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	XA,XB,XC,XD,XE,XF,XG

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Entity 35 Entity 35 polymer

Description description	Parkin coregulated gene protein homolog
Molecular weight formula_weight	27763.3 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	XH,XI,XJ,XK,XL,XM

MPKRTKLLPQQTFQVHQPRSLVSEGFTVKAMMKNSVVRGPPVAGAFKERPAKPTTFRKCYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLSEMTFPYEFFARRGIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQIICVTLKVLQHLVVSSEMVGEALLPYYRQILPILNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGEDAFINIKYMVPTYESCLLN

Entity 36 Entity 36 polymer

Description description	Cilia- and flagella-associated protein 210
Molecular weight formula_weight	65266.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,Z

MQVRFGRRSGQAKESQGMDCFEKEEIPYPPLLPSKVDLQQITIIPHAEWERIRDSLNRLTREAAVLRAERAAKKKMHVKSQELVKHWTNTYAGMKEQKLKAKQKRDEEIEAERKVLDLEEEIYKEGERKKAIESARQCQFHQTERVKRFHSGLLLSRVMKERDVQIQYKKNAVKSDKKWEEQVKLNDEKAFKEDQEKEEKRRRERVALAEDHLKQIEEHKEEEEARKKSEEKDAEEMKRQNLLYEIEMKKNLSKKQEEIDTNRKLLLDNMHNKNIIRAVEQQQQEEEDEKIRKFIKAKKRLIQMRMDKDAETHRLMEERRERINNFLSKLIKEKLDTEDLIIARDISEADAELEKREKEKHEKNQADLKAIAEYRASVMKNKEEEERQRKIEAKEQLQAVLKADKIFQELEKEKSLKVTREKLEIQDAHIQQIAINKYNAKQMKEEELDYWRLTDALTVEKEKEFEKYAREVINFESESTKKYAYPMVKAVQEGVGGGRGPPFVGRGGIRPSYQATDATGVQLPCFKSQGSKYNDFQKSKRRLGFTW

Entity 37 Entity 37 polymer

Description description	Sperm acrosome-associated protein 9
Molecular weight formula_weight	19512.4 kDa
Source method src_method	nat
Copy count entity_count	23

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	YA,YB,YC,YD,YE,YF,YG,YH,YI,YJ,YK,YL,YM,YN,YO,YP,YQ,YR,YS,YT,YU,YV,YW

MNEVKESLRSIEQKYKLFQQQQFTFIAALEHCRENAHDKIRPISSIEQVQSYMEHYCNNSTHRRILIMFMDICSELSKLCQHFEALHSGTPVTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLIPIVLDFMKEWIAHSEKLPRKVLQHGTT

Entity 38 Entity 38 polymer

Description description	Cilia- and flagella-associated protein 141
Molecular weight formula_weight	12278.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MSAEKMTKLEENLQRAVALKKTVDRWRNFHIHCMWQTTLDQRRNLFAALRMKDTKEQELALSNKQLLVVRQAALHELFEKEYQQYQQELNQMGKAFYEERL

Entity 39 Entity 39 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	279

▶

Resolution resolution	6.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	17450

In situ structure of axonemal doublet microtubules in mouse sperm with 48-nm repeat

1. Protein Identity and Related Structures Protein Identity & Related Structures

Meiosis-specific nuclear structural protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta-4B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Detyrosinated tubulin alpha-3 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nucleoside diphosphate kinase 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EF-hand domain-containing family member B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin bundle-interacting protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer