8to0

48-nm repeating structure of doublets from mouse sperm flagella

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cilia- and flagella-associated protein 95

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA95_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 0； PDBConstruct 1–228； UniProt 1–228 Author chain 7； PDBConstruct 1–228； UniProt 1–228

Tektin-1

OrganismNot specified

UniProt Q9DAJ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT1_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 1–418； UniProt 1–418 Author chain J； PDBConstruct 1–418； UniProt 1–418 Author chain K； PDBConstruct 1–418； UniProt 1–418 Author chain L； PDBConstruct 1–418； UniProt 1–418 Author chain M； PDBConstruct 1–418； UniProt 1–418

Detyrosinated tubulin alpha-1A chain

OrganismNot specified

UniProt P68369

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1A_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A5； PDBConstruct 1–451； UniProt 1–451 Author chain A7； PDBConstruct 1–451； UniProt 1–451 Author chain A9； PDBConstruct 1–451； UniProt 1–451 Author chain AM； PDBConstruct 1–451； UniProt 1–451 Author chain AO； PDBConstruct 1–451； UniProt 1–451 Author chain AQ； PDBConstruct 1–451； UniProt 1–451 Author chain AS； PDBConstruct 1–451； UniProt 1–451 Author chain AU； PDBConstruct 1–451； UniProt 1–451 Author chain AW； PDBConstruct 1–451； UniProt 1–451 Author chain AY； PDBConstruct 1–451； UniProt 1–451 Author chain Aj； PDBConstruct 1–451； UniProt 1–451 Author chain Al； PDBConstruct 1–451； UniProt 1–451 Author chain An； PDBConstruct 1–451； UniProt 1–451 Author chain Ap； PDBConstruct 1–451； UniProt 1–451 Author chain Ar； PDBConstruct 1–451； UniProt 1–451 Author chain At； PDBConstruct 1–451； UniProt 1–451 Author chain Av； PDBConstruct 1–451； UniProt 1–451 Author chain B0； PDBConstruct 1–451； UniProt 1–451 Author chain B2； PDBConstruct 1–451； UniProt 1–451 Author chain B4； PDBConstruct 1–451； UniProt 1–451 Author chain B8； PDBConstruct 1–451； UniProt 1–451 Author chain BA； PDBConstruct 1–451； UniProt 1–451 Author chain BC； PDBConstruct 1–451； UniProt 1–451 Author chain BE； PDBConstruct 1–451； UniProt 1–451 Author chain BO； PDBConstruct 1–451； UniProt 1–451 Author chain BQ； PDBConstruct 1–451； UniProt 1–451 Author chain BS； PDBConstruct 1–451； UniProt 1–451 Author chain BU； PDBConstruct 1–451； UniProt 1–451 Author chain BW； PDBConstruct 1–451； UniProt 1–451 Author chain BY； PDBConstruct 1–451； UniProt 1–451 Author chain Bc； PDBConstruct 1–451； UniProt 1–451 Author chain Be； PDBConstruct 1–451； UniProt 1–451 Author chain Bg； PDBConstruct 1–451； UniProt 1–451 Author chain Bi； PDBConstruct 1–451； UniProt 1–451 Author chain Bk； PDBConstruct 1–451； UniProt 1–451 Author chain Bm； PDBConstruct 1–451； UniProt 1–451 Author chain Br； PDBConstruct 1–451； UniProt 1–451 Author chain Bt； PDBConstruct 1–451； UniProt 1–451 Author chain Bv； PDBConstruct 1–451； UniProt 1–451 Author chain Bx； PDBConstruct 1–451； UniProt 1–451 Author chain Bz； PDBConstruct 1–451； UniProt 1–451 Author chain C0； PDBConstruct 1–451； UniProt 1–451 Author chain C1； PDBConstruct 1–451； UniProt 1–451 Author chain C3； PDBConstruct 1–451； UniProt 1–451 Author chain C8； PDBConstruct 1–451； UniProt 1–451 Author chain CB； PDBConstruct 1–451； UniProt 1–451 Author chain CD； PDBConstruct 1–451； UniProt 1–451 Author chain CF； PDBConstruct 1–451； UniProt 1–451 Author chain CH； PDBConstruct 1–451； UniProt 1–451 Author chain CJ； PDBConstruct 1–451； UniProt 1–451 Author chain CN； PDBConstruct 1–451； UniProt 1–451 Author chain CP； PDBConstruct 1–451； UniProt 1–451 Author chain CR； PDBConstruct 1–451； UniProt 1–451 Author chain CT； PDBConstruct 1–451； UniProt 1–451 Author chain CV； PDBConstruct 1–451； UniProt 1–451 Author chain CX； PDBConstruct 1–451； UniProt 1–451 Author chain Cc； PDBConstruct 1–451； UniProt 1–451 Author chain Ce； PDBConstruct 1–451； UniProt 1–451 Author chain Cg； PDBConstruct 1–451； UniProt 1–451 Author chain Ci； PDBConstruct 1–451； UniProt 1–451 Author chain Ck； PDBConstruct 1–451； UniProt 1–451 Author chain Cm； PDBConstruct 1–451； UniProt 1–451 Author chain Co； PDBConstruct 1–451； UniProt 1–451 Author chain Cs； PDBConstruct 1–451； UniProt 1–451 Author chain Cu； PDBConstruct 1–451； UniProt 1–451 Author chain Cw； PDBConstruct 1–451； UniProt 1–451 Author chain Cy； PDBConstruct 1–451； UniProt 1–451 Author chain D2； PDBConstruct 1–451； UniProt 1–451 Author chain D5； PDBConstruct 1–451； UniProt 1–451 Author chain D7； PDBConstruct 1–451； UniProt 1–451 Author chain D9； PDBConstruct 1–451； UniProt 1–451 Author chain DB； PDBConstruct 1–451； UniProt 1–451 Author chain DD； PDBConstruct 1–451； UniProt 1–451 Author chain DF； PDBConstruct 1–451； UniProt 1–451 Author chain DH； PDBConstruct 1–451； UniProt 1–451 Author chain DM； PDBConstruct 1–451； UniProt 1–451 Author chain DO； PDBConstruct 1–451； UniProt 1–451 Author chain DQ； PDBConstruct 1–451； UniProt 1–451 Author chain DS； PDBConstruct 1–451； UniProt 1–451 Author chain DU； PDBConstruct 1–451； UniProt 1–451 Author chain DW； PDBConstruct 1–451； UniProt 1–451 Author chain Db； PDBConstruct 1–451； UniProt 1–451 Author chain Dd； PDBConstruct 1–451； UniProt 1–451 Author chain Df； PDBConstruct 1–451； UniProt 1–451 Author chain Dh； PDBConstruct 1–451； UniProt 1–451 Author chain Dj； PDBConstruct 1–451； UniProt 1–451 Author chain Dl； PDBConstruct 1–451； UniProt 1–451 Author chain Dp； PDBConstruct 1–451； UniProt 1–451 Author chain Dr； PDBConstruct 1–451； UniProt 1–451 Author chain Dt； PDBConstruct 1–451； UniProt 1–451 Author chain Dv； PDBConstruct 1–451； UniProt 1–451 Author chain Dx； PDBConstruct 1–451； UniProt 1–451 Author chain Dz； PDBConstruct 1–451； UniProt 1–451 Author chain E3； PDBConstruct 1–451； UniProt 1–451 Author chain E5； PDBConstruct 1–451； UniProt 1–451 Author chain E7； PDBConstruct 1–451； UniProt 1–451 Author chain E9； PDBConstruct 1–451； UniProt 1–451 Author chain EA； PDBConstruct 1–451； UniProt 1–451 Author chain EC； PDBConstruct 1–451； UniProt 1–451 Author chain EE； PDBConstruct 1–451； UniProt 1–451 Author chain EG； PDBConstruct 1–451； UniProt 1–451 Author chain EJ； PDBConstruct 1–451； UniProt 1–451 Author chain EL； PDBConstruct 1–451； UniProt 1–451 Author chain EN； PDBConstruct 1–451； UniProt 1–451 Author chain EP； PDBConstruct 1–451； UniProt 1–451 Author chain ER； PDBConstruct 1–451； UniProt 1–451 Author chain ET； PDBConstruct 1–451； UniProt 1–451 Author chain EV； PDBConstruct 1–451； UniProt 1–451 Author chain EY； PDBConstruct 1–451； UniProt 1–451 Author chain Ea； PDBConstruct 1–451； UniProt 1–451 Author chain Ec； PDBConstruct 1–451； UniProt 1–451 Author chain Ee； PDBConstruct 1–451； UniProt 1–451 Author chain Eg； PDBConstruct 1–451； UniProt 1–451 Author chain Ei； PDBConstruct 1–451； UniProt 1–451 Author chain Ek； PDBConstruct 1–451； UniProt 1–451 Author chain Eo； PDBConstruct 1–451； UniProt 1–451 Author chain Eq； PDBConstruct 1–451； UniProt 1–451 Author chain Es； PDBConstruct 1–451； UniProt 1–451 Author chain Eu； PDBConstruct 1–451； UniProt 1–451 Author chain Ew； PDBConstruct 1–451； UniProt 1–451 Author chain Ey； PDBConstruct 1–451； UniProt 1–451 Author chain FA； PDBConstruct 1–451； UniProt 1–451 Author chain FC； PDBConstruct 1–451； UniProt 1–451 Author chain FG； PDBConstruct 1–451； UniProt 1–451 Author chain FI； PDBConstruct 1–451； UniProt 1–451 Author chain FK； PDBConstruct 1–451； UniProt 1–451 Author chain FM； PDBConstruct 1–451； UniProt 1–451 Author chain FO； PDBConstruct 1–451； UniProt 1–451 Author chain FQ； PDBConstruct 1–451； UniProt 1–451 Author chain FU； PDBConstruct 1–451； UniProt 1–451 Author chain FW； PDBConstruct 1–451； UniProt 1–451 Author chain FY； PDBConstruct 1–451； UniProt 1–451 Author chain Fa； PDBConstruct 1–451； UniProt 1–451 Author chain Fc； PDBConstruct 1–451； UniProt 1–451 Author chain Fe； PDBConstruct 1–451； UniProt 1–451 Author chain N； PDBConstruct 1–451； UniProt 1–451 Author chain P； PDBConstruct 1–451； UniProt 1–451 Author chain R； PDBConstruct 1–451； UniProt 1–451 Author chain T； PDBConstruct 1–451； UniProt 1–451 Author chain V； PDBConstruct 1–451； UniProt 1–451 Author chain X； PDBConstruct 1–451； UniProt 1–451 Author chain Z； PDBConstruct 1–451； UniProt 1–451 Author chain n； PDBConstruct 1–451； UniProt 1–451 Author chain p； PDBConstruct 1–451； UniProt 1–451 Author chain r； PDBConstruct 1–451； UniProt 1–451 Author chain t； PDBConstruct 1–451； UniProt 1–451 Author chain v； PDBConstruct 1–451； UniProt 1–451 Author chain x； PDBConstruct 1–451； UniProt 1–451 Author chain z； PDBConstruct 1–451； UniProt 1–451

Tubulin beta-4B chain

OrganismNot specified

UniProt P68372

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB4B_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A0； PDBConstruct 1–445； UniProt 1–445 Author chain A4； PDBConstruct 1–445； UniProt 1–445 Author chain A6； PDBConstruct 1–445； UniProt 1–445 Author chain A8； PDBConstruct 1–445； UniProt 1–445 Author chain AN； PDBConstruct 1–445； UniProt 1–445 Author chain AP； PDBConstruct 1–445； UniProt 1–445 Author chain AR； PDBConstruct 1–445； UniProt 1–445 Author chain AT； PDBConstruct 1–445； UniProt 1–445 Author chain AV； PDBConstruct 1–445； UniProt 1–445 Author chain AX； PDBConstruct 1–445； UniProt 1–445 Author chain Ak； PDBConstruct 1–445； UniProt 1–445 Author chain Am； PDBConstruct 1–445； UniProt 1–445 Author chain Ao； PDBConstruct 1–445； UniProt 1–445 Author chain Aq； PDBConstruct 1–445； UniProt 1–445 Author chain As； PDBConstruct 1–445； UniProt 1–445 Author chain Au； PDBConstruct 1–445； UniProt 1–445 Author chain Aw； PDBConstruct 1–445； UniProt 1–445 Author chain B1； PDBConstruct 1–445； UniProt 1–445 Author chain B3； PDBConstruct 1–445； UniProt 1–445 Author chain B7； PDBConstruct 1–445； UniProt 1–445 Author chain B9； PDBConstruct 1–445； UniProt 1–445 Author chain BB； PDBConstruct 1–445； UniProt 1–445 Author chain BD； PDBConstruct 1–445； UniProt 1–445 Author chain BF； PDBConstruct 1–445； UniProt 1–445 Author chain BN； PDBConstruct 1–445； UniProt 1–445 Author chain BP； PDBConstruct 1–445； UniProt 1–445 Author chain BR； PDBConstruct 1–445； UniProt 1–445 Author chain BT； PDBConstruct 1–445； UniProt 1–445 Author chain BV； PDBConstruct 1–445； UniProt 1–445 Author chain BX； PDBConstruct 1–445； UniProt 1–445 Author chain BZ； PDBConstruct 1–445； UniProt 1–445 Author chain Bb； PDBConstruct 1–445； UniProt 1–445 Author chain Bd； PDBConstruct 1–445； UniProt 1–445 Author chain Bf； PDBConstruct 1–445； UniProt 1–445 Author chain Bh； PDBConstruct 1–445； UniProt 1–445 Author chain Bj； PDBConstruct 1–445； UniProt 1–445 Author chain Bl； PDBConstruct 1–445； UniProt 1–445 Author chain Bn； PDBConstruct 1–445； UniProt 1–445 Author chain Bq； PDBConstruct 1–445； UniProt 1–445 Author chain Bs； PDBConstruct 1–445； UniProt 1–445 Author chain Bu； PDBConstruct 1–445； UniProt 1–445 Author chain Bw； PDBConstruct 1–445； UniProt 1–445 Author chain By； PDBConstruct 1–445； UniProt 1–445 Author chain C2； PDBConstruct 1–445； UniProt 1–445 Author chain C4； PDBConstruct 1–445； UniProt 1–445 Author chain C7； PDBConstruct 1–445； UniProt 1–445 Author chain C9； PDBConstruct 1–445； UniProt 1–445 Author chain CA； PDBConstruct 1–445； UniProt 1–445 Author chain CC； PDBConstruct 1–445； UniProt 1–445 Author chain CE； PDBConstruct 1–445； UniProt 1–445 Author chain CG； PDBConstruct 1–445； UniProt 1–445 Author chain CI； PDBConstruct 1–445； UniProt 1–445 Author chain CM； PDBConstruct 1–445； UniProt 1–445 Author chain CO； PDBConstruct 1–445； UniProt 1–445 Author chain CQ； PDBConstruct 1–445； UniProt 1–445 Author chain CS； PDBConstruct 1–445； UniProt 1–445 Author chain CU； PDBConstruct 1–445； UniProt 1–445 Author chain CW； PDBConstruct 1–445； UniProt 1–445 Author chain CY； PDBConstruct 1–445； UniProt 1–445 Author chain Cb； PDBConstruct 1–445； UniProt 1–445 Author chain Cd； PDBConstruct 1–445； UniProt 1–445 Author chain Cf； PDBConstruct 1–445； UniProt 1–445 Author chain Ch； PDBConstruct 1–445； UniProt 1–445 Author chain Cj； PDBConstruct 1–445； UniProt 1–445 Author chain Cl； PDBConstruct 1–445； UniProt 1–445 Author chain Cn； PDBConstruct 1–445； UniProt 1–445 Author chain Cr； PDBConstruct 1–445； UniProt 1–445 Author chain Ct； PDBConstruct 1–445； UniProt 1–445 Author chain Cv； PDBConstruct 1–445； UniProt 1–445 Author chain Cx； PDBConstruct 1–445； UniProt 1–445 Author chain Cz； PDBConstruct 1–445； UniProt 1–445 Author chain D0； PDBConstruct 1–445； UniProt 1–445 Author chain D1； PDBConstruct 1–445； UniProt 1–445 Author chain D6； PDBConstruct 1–445； UniProt 1–445 Author chain D8； PDBConstruct 1–445； UniProt 1–445 Author chain DA； PDBConstruct 1–445； UniProt 1–445 Author chain DC； PDBConstruct 1–445； UniProt 1–445 Author chain DE； PDBConstruct 1–445； UniProt 1–445 Author chain DG； PDBConstruct 1–445； UniProt 1–445 Author chain DI； PDBConstruct 1–445； UniProt 1–445 Author chain DL； PDBConstruct 1–445； UniProt 1–445 Author chain DN； PDBConstruct 1–445； UniProt 1–445 Author chain DP； PDBConstruct 1–445； UniProt 1–445 Author chain DR； PDBConstruct 1–445； UniProt 1–445 Author chain DT； PDBConstruct 1–445； UniProt 1–445 Author chain DV； PDBConstruct 1–445； UniProt 1–445 Author chain DX； PDBConstruct 1–445； UniProt 1–445 Author chain Da； PDBConstruct 1–445； UniProt 1–445 Author chain Dc； PDBConstruct 1–445； UniProt 1–445 Author chain De； PDBConstruct 1–445； UniProt 1–445 Author chain Dg； PDBConstruct 1–445； UniProt 1–445 Author chain Di； PDBConstruct 1–445； UniProt 1–445 Author chain Dk； PDBConstruct 1–445； UniProt 1–445 Author chain Dm； PDBConstruct 1–445； UniProt 1–445 Author chain Dq； PDBConstruct 1–445； UniProt 1–445 Author chain Ds； PDBConstruct 1–445； UniProt 1–445 Author chain Du； PDBConstruct 1–445； UniProt 1–445 Author chain Dw； PDBConstruct 1–445； UniProt 1–445 Author chain Dy； PDBConstruct 1–445； UniProt 1–445 Author chain E0； PDBConstruct 1–445； UniProt 1–445 Author chain E2； PDBConstruct 1–445； UniProt 1–445 Author chain E4； PDBConstruct 1–445； UniProt 1–445 Author chain E6； PDBConstruct 1–445； UniProt 1–445 Author chain E8； PDBConstruct 1–445； UniProt 1–445 Author chain EB； PDBConstruct 1–445； UniProt 1–445 Author chain ED； PDBConstruct 1–445； UniProt 1–445 Author chain EF； PDBConstruct 1–445； UniProt 1–445 Author chain EK； PDBConstruct 1–445； UniProt 1–445 Author chain EM； PDBConstruct 1–445； UniProt 1–445 Author chain EO； PDBConstruct 1–445； UniProt 1–445 Author chain EQ； PDBConstruct 1–445； UniProt 1–445 Author chain ES； PDBConstruct 1–445； UniProt 1–445 Author chain EU； PDBConstruct 1–445； UniProt 1–445 Author chain EZ； PDBConstruct 1–445； UniProt 1–445 Author chain Eb； PDBConstruct 1–445； UniProt 1–445 Author chain Ed； PDBConstruct 1–445； UniProt 1–445 Author chain Ef； PDBConstruct 1–445； UniProt 1–445 Author chain Eh； PDBConstruct 1–445； UniProt 1–445 Author chain Ej； PDBConstruct 1–445； UniProt 1–445 Author chain En； PDBConstruct 1–445； UniProt 1–445 Author chain Ep； PDBConstruct 1–445； UniProt 1–445 Author chain Er； PDBConstruct 1–445； UniProt 1–445 Author chain Et； PDBConstruct 1–445； UniProt 1–445 Author chain Ev； PDBConstruct 1–445； UniProt 1–445 Author chain Ex； PDBConstruct 1–445； UniProt 1–445 Author chain FB； PDBConstruct 1–445； UniProt 1–445 Author chain FD； PDBConstruct 1–445； UniProt 1–445 Author chain FF； PDBConstruct 1–445； UniProt 1–445 Author chain FH； PDBConstruct 1–445； UniProt 1–445 Author chain FJ； PDBConstruct 1–445； UniProt 1–445 Author chain FL； PDBConstruct 1–445； UniProt 1–445 Author chain FN； PDBConstruct 1–445； UniProt 1–445 Author chain FP； PDBConstruct 1–445； UniProt 1–445 Author chain FR； PDBConstruct 1–445； UniProt 1–445 Author chain FT； PDBConstruct 1–445； UniProt 1–445 Author chain FV； PDBConstruct 1–445； UniProt 1–445 Author chain FX； PDBConstruct 1–445； UniProt 1–445 Author chain FZ； PDBConstruct 1–445； UniProt 1–445 Author chain Fb； PDBConstruct 1–445； UniProt 1–445 Author chain Fd； PDBConstruct 1–445； UniProt 1–445 Author chain Ff； PDBConstruct 1–445； UniProt 1–445 Author chain O； PDBConstruct 1–445； UniProt 1–445 Author chain Q； PDBConstruct 1–445； UniProt 1–445 Author chain S； PDBConstruct 1–445； UniProt 1–445 Author chain U； PDBConstruct 1–445； UniProt 1–445 Author chain W； PDBConstruct 1–445； UniProt 1–445 Author chain Y； PDBConstruct 1–445； UniProt 1–445 Author chain o； PDBConstruct 1–445； UniProt 1–445 Author chain q； PDBConstruct 1–445； UniProt 1–445 Author chain s； PDBConstruct 1–445； UniProt 1–445 Author chain u； PDBConstruct 1–445； UniProt 1–445 Author chain w； PDBConstruct 1–445； UniProt 1–445 Author chain y； PDBConstruct 1–445； UniProt 1–445

Tektin-2

OrganismNot specified

UniProt Q922G7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT2_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain b； PDBConstruct 1–430； UniProt 1–430 Author chain e； PDBConstruct 1–430； UniProt 1–430 Author chain f； PDBConstruct 1–430； UniProt 1–430 Author chain g； PDBConstruct 1–430； UniProt 1–430 Author chain h； PDBConstruct 1–430； UniProt 1–430 Author chain i； PDBConstruct 1–430； UniProt 1–430 Author chain j； PDBConstruct 1–430； UniProt 1–430 Author chain k； PDBConstruct 1–430； UniProt 1–430 Author chain l； PDBConstruct 1–430； UniProt 1–430 Author chain m； PDBConstruct 1–430； UniProt 1–430

EF-hand domain-containing family member B

OrganismNot specified

UniProt Q8CDU5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHB_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 1； PDBConstruct 1–853； UniProt 1–853 Author chain 2； PDBConstruct 1–853； UniProt 1–853

Tektin-3

OrganismNot specified

UniProt Q6X6Z7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT3_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AC； PDBConstruct 1–490； UniProt 1–490 Author chain AD； PDBConstruct 1–490； UniProt 1–490 Author chain AE； PDBConstruct 1–490； UniProt 1–490 Author chain AF； PDBConstruct 1–490； UniProt 1–490 Author chain AG； PDBConstruct 1–490； UniProt 1–490 Author chain AH； PDBConstruct 1–490； UniProt 1–490 Author chain AI； PDBConstruct 1–490； UniProt 1–490 Author chain AJ； PDBConstruct 1–490； UniProt 1–490 Author chain AK； PDBConstruct 1–490； UniProt 1–490 Author chain AL； PDBConstruct 1–490； UniProt 1–490 Author chain BI； PDBConstruct 1–490； UniProt 1–490 Author chain BJ； PDBConstruct 1–490； UniProt 1–490 Author chain BK； PDBConstruct 1–490； UniProt 1–490 Author chain BL； PDBConstruct 1–490； UniProt 1–490 Author chain BM； PDBConstruct 1–490； UniProt 1–490

Meiosis-specific nuclear structural protein 1

OrganismNot specified

UniProt Q61884

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MNS1_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A； PDBConstruct 1–491； UniProt 1–491 Author chain a； PDBConstruct 1–491； UniProt 1–491

Tektin-4

OrganismNot specified

UniProt Q149S1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT4_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–447； UniProt 1–447 Author chain Ab； PDBConstruct 1–447； UniProt 1–447 Author chain Ac； PDBConstruct 1–447； UniProt 1–447 Author chain Ad； PDBConstruct 1–447； UniProt 1–447 Author chain Af； PDBConstruct 1–447； UniProt 1–447 Author chain Ag； PDBConstruct 1–447； UniProt 1–447 Author chain Ah； PDBConstruct 1–447； UniProt 1–447 Author chain Ai； PDBConstruct 1–447； UniProt 1–447

Cilia- and flagella-associated protein 53

OrganismNot specified

UniProt Q9D439

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA53_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain 3； PDBConstruct 1–514； UniProt 1–514 Author chain 4； PDBConstruct 1–514； UniProt 1–514

Tektin bundle-interacting protein 1

OrganismNot specified

UniProt A6H6Q4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TKTI1_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain A1； PDBConstruct 1–206； UniProt 1–206 Author chain A2； PDBConstruct 1–206； UniProt 1–206 Author chain A3； PDBConstruct 1–206； UniProt 1–206 Author chain Az； PDBConstruct 1–206； UniProt 1–206

Cilia- and flagella-associated protein 141

OrganismNot specified

UniProt Q9D9D9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CP141_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain AB； PDBConstruct 1–101； UniProt 1–101

Nucleoside diphosphate kinase 7

OrganismNot specified

UniProt Q9QXL8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDK7_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain 5； PDBConstruct 1–395； UniProt 1–395 Author chain 6； PDBConstruct 1–395； UniProt 1–395

Protein FAM166B

OrganismNot specified

UniProt A2AIP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F166B_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain B6； PDBConstruct 1–273； UniProt 1–273 Author chain C6； PDBConstruct 1–273； UniProt 1–273 Author chain CL； PDBConstruct 1–273； UniProt 1–273 Author chain Ca； PDBConstruct 1–273； UniProt 1–273 Author chain Cq； PDBConstruct 1–273； UniProt 1–273 Author chain DK； PDBConstruct 1–273； UniProt 1–273

Sperm-associated antigen 8

OrganismNot specified

UniProt Q3V0Q6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPAG8_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain AZ； PDBConstruct 1–470； UniProt 1–470

RIB43A-like with coiled-coils protein 2

OrganismNot specified

UniProt Q9D4Q1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RIBC2_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain D4； PDBConstruct 1–377； UniProt 1–377 Author chain DZ； PDBConstruct 1–377； UniProt 1–377 Author chain Do； PDBConstruct 1–377； UniProt 1–377 Author chain EI； PDBConstruct 1–377； UniProt 1–377 Author chain EX； PDBConstruct 1–377； UniProt 1–377

Cilia- and flagella-associated protein 107

OrganismNot specified

UniProt Q4KKZ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF107_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 8； PDBConstruct 1–196； UniProt 1–196 Author chain 9； PDBConstruct 1–196； UniProt 1–196

Cilia- and flagella-associated protein 161

OrganismNot specified

UniProt Q6P8Y0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF161_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain Ay； PDBConstruct 1–303； UniProt 1–303 Author chain BH； PDBConstruct 1–303； UniProt 1–303

EF-hand domain-containing protein 1

OrganismNot specified

UniProt Q9D9T8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC1_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain E1； PDBConstruct 1–648； UniProt 1–648 Author chain Em； PDBConstruct 1–648； UniProt 1–648 Author chain FE； PDBConstruct 1–648； UniProt 1–648

Sperm acrosome-associated protein 9

OrganismNot specified

UniProt Q7TPM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SACA9_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain F0； PDBConstruct 1–168； UniProt 1–168 Author chain F1； PDBConstruct 1–168； UniProt 1–168 Author chain F2； PDBConstruct 1–168； UniProt 1–168 Author chain F3； PDBConstruct 1–168； UniProt 1–168 Author chain F4； PDBConstruct 1–168； UniProt 1–168 Author chain F5； PDBConstruct 1–168； UniProt 1–168 Author chain F6； PDBConstruct 1–168； UniProt 1–168 Author chain F7； PDBConstruct 1–168； UniProt 1–168 Author chain F8； PDBConstruct 1–168； UniProt 1–168 Author chain F9； PDBConstruct 1–168； UniProt 1–168 Author chain GA； PDBConstruct 1–168； UniProt 1–168 Author chain GB； PDBConstruct 1–168； UniProt 1–168 Author chain GC； PDBConstruct 1–168； UniProt 1–168 Author chain GD； PDBConstruct 1–168； UniProt 1–168 Author chain GE； PDBConstruct 1–168； UniProt 1–168 Author chain GF； PDBConstruct 1–168； UniProt 1–168 Author chain GG； PDBConstruct 1–168； UniProt 1–168 Author chain GH； PDBConstruct 1–168； UniProt 1–168 Author chain GI； PDBConstruct 1–168； UniProt 1–168 Author chain GJ； PDBConstruct 1–168； UniProt 1–168 Author chain GK； PDBConstruct 1–168； UniProt 1–168 Author chain GL； PDBConstruct 1–168； UniProt 1–168 Author chain GM； PDBConstruct 1–168； UniProt 1–168 Author chain GN； PDBConstruct 1–168； UniProt 1–168 Author chain GO； PDBConstruct 1–168； UniProt 1–168 Author chain GP； PDBConstruct 1–168； UniProt 1–168 Author chain GQ； PDBConstruct 1–168； UniProt 1–168

EF-hand domain-containing family member C2

OrganismNot specified

UniProt Q9D485

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFHC2_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain FS； PDBConstruct 1–750； UniProt 1–750 Author chain Fg； PDBConstruct 1–750； UniProt 1–750 Author chain Fo； PDBConstruct 1–750； UniProt 1–750 Author chain Fv； PDBConstruct 1–750； UniProt 1–750

Cilia- and flagella-associated protein 20

OrganismNot specified

UniProt Q8BTU1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA20_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain Fh； PDBConstruct 1–193； UniProt 1–193 Author chain Fi； PDBConstruct 1–193； UniProt 1–193 Author chain Fj； PDBConstruct 1–193； UniProt 1–193 Author chain Fk； PDBConstruct 1–193； UniProt 1–193 Author chain Fl； PDBConstruct 1–193； UniProt 1–193 Author chain Fm； PDBConstruct 1–193； UniProt 1–193 Author chain Fn； PDBConstruct 1–193； UniProt 1–193

Parkin coregulated gene protein homolog

OrganismNot specified

UniProt Q9DAK2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PACRG_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Fp； PDBConstruct 1–241； UniProt 1–241 Author chain Fq； PDBConstruct 1–241； UniProt 1–241 Author chain Fr； PDBConstruct 1–241； UniProt 1–241 Author chain Fs； PDBConstruct 1–241； UniProt 1–241 Author chain Ft； PDBConstruct 1–241； UniProt 1–241

Dual specificity protein phosphatase 3

OrganismNot specified

UniProt Q9D7X3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DUS3_MOUSE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Fx； PDBConstruct 1–185； UniProt 1–185 Author chain Fy； PDBConstruct 1–185； UniProt 1–185 Author chain Fz； PDBConstruct 1–185； UniProt 1–185

Piercer of microtubule wall 2 protein

OrganismNot specified

UniProt V9GXK1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PIRC2_MOUSE
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain G； PDBConstruct 1–122； UniProt 1–122

Tektin-5

OrganismNot specified

UniProt G5E8A8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TEKT5_MOUSE
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain GR； PDBConstruct 1–557； UniProt 1–557 Author chain GS； PDBConstruct 1–557； UniProt 1–557 Author chain GT； PDBConstruct 1–557； UniProt 1–557 Author chain GU； PDBConstruct 1–557； UniProt 1–557 Author chain GV； PDBConstruct 1–557； UniProt 1–557 Author chain GW； PDBConstruct 1–557； UniProt 1–557 Author chain GX； PDBConstruct 1–557； UniProt 1–557 Author chain GY； PDBConstruct 1–557； UniProt 1–557 Author chain GZ； PDBConstruct 1–557； UniProt 1–557 Author chain Ga； PDBConstruct 1–557； UniProt 1–557 Author chain Gb； PDBConstruct 1–557； UniProt 1–557 Author chain Gc； PDBConstruct 1–557； UniProt 1–557 Author chain Gd； PDBConstruct 1–557； UniProt 1–557 Author chain Ge； PDBConstruct 1–557； UniProt 1–557 Author chain Gf； PDBConstruct 1–557； UniProt 1–557 Author chain Gg； PDBConstruct 1–557； UniProt 1–557 Author chain Gh； PDBConstruct 1–557； UniProt 1–557 Author chain Gi； PDBConstruct 1–557； UniProt 1–557 Author chain Gj； PDBConstruct 1–557； UniProt 1–557 Author chain z0； PDBConstruct 1–557； UniProt 1–557 Author chain z1； PDBConstruct 1–557； UniProt 1–557 Author chain z3； PDBConstruct 1–557； UniProt 1–557 Author chain z4； PDBConstruct 1–557； UniProt 1–557

Cilia- and flagella-associated protein 45

OrganismNot specified

UniProt Q9D9U9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA45_MOUSE
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain AA； PDBConstruct 1–551； UniProt 1–551 Author chain Ax； PDBConstruct 1–551； UniProt 1–551 Author chain B； PDBConstruct 1–551； UniProt 1–551 Author chain c； PDBConstruct 1–551； UniProt 1–551 Author chain d； PDBConstruct 1–551； UniProt 1–551

Cilia- and flagella-associated protein 52

OrganismNot specified

UniProt Q5F201

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CFA52_MOUSE
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain BG； PDBConstruct 1–620； UniProt 1–620 Author chain Ba； PDBConstruct 1–620； UniProt 1–620 Author chain Bo； PDBConstruct 1–620； UniProt 1–620

Enkurin

OrganismNot specified

UniProt Q6SP97

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ENKUR_MOUSE
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain B5； PDBConstruct 1–255； UniProt 1–255 Author chain CK； PDBConstruct 1–255； UniProt 1–255 Author chain CZ； PDBConstruct 1–255； UniProt 1–255 Author chain Cp； PDBConstruct 1–255； UniProt 1–255

Protein Flattop

OrganismNot specified

UniProt Q6P8X9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FLTOP_MOUSE
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain C5； PDBConstruct 1–189； UniProt 1–189 Author chain DJ； PDBConstruct 1–189； UniProt 1–189 Author chain DY； PDBConstruct 1–189； UniProt 1–189

Cilia- and flagella- associated protein 210

OrganismNot specified

UniProt A0JLY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF210_MOUSE
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain D3； PDBConstruct 1–547； UniProt 1–547 Author chain Dn； PDBConstruct 1–547； UniProt 1–547

Cilia- and flagella-associated protein 276

OrganismNot specified

UniProt Q9DAD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CF276_MOUSE
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain EH； PDBConstruct 1–168； UniProt 1–168 Author chain EW； PDBConstruct 1–168； UniProt 1–168 Author chain El； PDBConstruct 1–168； UniProt 1–168

EF-hand calcium-binding domain-containing protein 6

OrganismNot specified

UniProt Q6P1E8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFCB6_MOUSE
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain Ez； PDBConstruct 1–1516； UniProt 1–1516

Coiled-coil domain-containing protein 105

OrganismNot specified

UniProt Q9D4K7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Piercer of microtubule wall 1 protein × 1 （Q5BN45）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CC105_MOUSE
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain C； PDBConstruct 1–499； UniProt 1–499 Author chain D； PDBConstruct 1–499； UniProt 1–499 Author chain E； PDBConstruct 1–499； UniProt 1–499 Author chain F； PDBConstruct 1–499； UniProt 1–499 Author chain H； PDBConstruct 1–499； UniProt 1–499

Piercer of microtubule wall 1 protein

OrganismNot specified

UniProt Q5BN45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 471	Cilia- and flagella-associated protein 95 × 2 （Q9CQC3） Tektin-1 × 5 （Q9DAJ2） Detyrosinated tubulin alpha-1A chain × 149 （P68369） Tubulin beta-4B chain × 153 （P68372） Tektin-2 × 10 （Q922G7） EF-hand domain-containing family member B × 2 （Q8CDU5） Tektin-3 × 15 （Q6X6Z7） Meiosis-specific nuclear structural protein 1 × 2 （Q61884） Tektin-4 × 8 （Q149S1） Cilia- and flagella-associated protein 53 × 2 （Q9D439） Tektin bundle-interacting protein 1 × 4 （A6H6Q4） Cilia- and flagella-associated protein 141 × 1 （Q9D9D9） Nucleoside diphosphate kinase 7 × 2 （Q9QXL8） Protein FAM166B × 6 （A2AIP0） Sperm-associated antigen 8 × 1 （Q3V0Q6） RIB43A-like with coiled-coils protein 2 × 5 （Q9D4Q1） Cilia- and flagella-associated protein 107 × 2 （Q4KKZ1） Cilia- and flagella-associated protein 161 × 2 （Q6P8Y0） EF-hand domain-containing protein 1 × 3 （Q9D9T8） Sperm acrosome-associated protein 9 × 27 （Q7TPM5） EF-hand domain-containing family member C2 × 4 （Q9D485） Cilia- and flagella-associated protein 20 × 7 （Q8BTU1） Parkin coregulated gene protein homolog × 5 （Q9DAK2） Dual specificity protein phosphatase 3 × 3 （Q9D7X3） Piercer of microtubule wall 2 protein × 1 （V9GXK1） Tektin-5 × 23 （G5E8A8） Cilia- and flagella-associated protein 45 × 5 （Q9D9U9） Cilia- and flagella-associated protein 52 × 3 （Q5F201） Enkurin × 4 （Q6SP97） Protein Flattop × 3 （Q6P8X9） Cilia- and flagella- associated protein 210 × 2 （A0JLY1） Cilia- and flagella-associated protein 276 × 3 （Q9DAD0） EF-hand calcium-binding domain-containing protein 6 × 1 （Q6P1E8） Coiled-coil domain-containing protein 105 × 5 （Q9D4K7）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PIRC1_MOUSE
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain Fw； PDBConstruct 1–167； UniProt 1–167

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8to0
Deposition date deposition_date	2023-08-02
Structure title title	48-nm repeating structure of doublets from mouse sperm flagella
Keywords keywords	;Mammalian sperm, axoneme, microtubule-based structure, microtubule inner protein, non-motor proteins, cellular motility, fertility, structural protein ;; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8to0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8to0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8to0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	218.70 Å
Total Rg	218.70 Å
Atom count	673884
Residues	168471
Excluded volume	9289300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8to0__assembly_1__model_1`	471-meric （471）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (35)

Entity 1 Entity 1 polymer

Description description	Cilia- and flagella-associated protein 95
Molecular weight formula_weight	26633.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,7
Atom count atom_count	673884

MGTFDSQCHECFESKERWYEIGPTDLLERKGSLTLRSHHKKYSEPVLVYSWHRNREAFPKDYDIESLETVKNLCMSTYKRFGSDSPRWMSEAREQMAQVLVNKDLVEKKKTGLLDEETLCPGILERDPELPPTGFRDVPMESPPDPRKPCFSTTYSEDFTPQYEYPPPACPRREEYSIVHRKCRSQFTDLNGSKRLGINTWHDESGIYANSEAKQKLYALARNPIVPF

Entity 2 Entity 2 polymer

Description description	Tektin-1
Molecular weight formula_weight	48713.0 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M,I,J,K

MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIPPRDGDDHGAWEGGIRAEAIC

Entity 3 Entity 3 polymer

Description description	Detyrosinated tubulin alpha-1A chain
Molecular weight formula_weight	50188.4 kDa
Source method src_method	nat
Copy count entity_count	149

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;N,P,R,T,V,X,Z,n,p,r,t,v,x,z,BQ,BS,BU,BW,BY,AW,AY,Aj,Al,An,Ap,Ar,At,Av,A5,A7,A9,BA,BC,BE,BO,CX,Cc,Ce,Cg,Ci,Bc,Be,Bg,Bi,Bk,Bm,Br,Bt,Bv,Bx,Bz,B2,B4,B8,B0,CB,CD,CF,CH,CJ,CN,CP,CR,CT,CV,Dj,Dl,Dp,Dr,Ck,Cm,Co,Cs,Cu,Cw,Cy,C1,C3,C8,C0,DB,DD,DF,DH,DM,DO,DQ,DS,DU,DW,Db,Dd,Df,Dh,Es,Eu,Ew,Ey,E3,Dt,Dv,Dx,Dz,D2,D5,D7,D9,EA,EC,EE,EG,EJ,EL,EN,EP,ER,ET,EV,EY,Ea,Ec,Ee,Eg,Ei,Ek,Eo,Eq,E5,AM,E7,E9,FA,FC,FG,FI,FK,FM,FO,FQ,FU,FW,FY,Fa,Fc,Fe,AO,AQ,AS,AU ;

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Entity 4 Entity 4 polymer

Description description	Tubulin beta-4B chain
Molecular weight formula_weight	49877.8 kDa
Source method src_method	nat
Copy count entity_count	153

Polymer Polymer

Polymer type type

polypeptide(L)

Chain IDs strand_id

;O,Q,S,U,W,Y,o,q,s,u,w,y,BR,BT,BV,BX,BZ,AV,AX,Ak,Am,Ao,Aq,As,Au,Aw,A4,A6,A8,A0,BB,BD,BF,BN,BP,CY,Cb,Cd,Cf,Ch,Bb,Bd,Bf,Bh,Bj,Bl,Bn,Bs,Bu,Bw,By,B1,B3,B7,B9,CA,CC,CE,CG,CI,CM,CO,CQ,CS,CU,CW,Di,Dk,Dm,Dq,Ds,Cj,Cl,Cn,Cr,Ct,Cv,Cx,Cz,C2,C4,C7,C9,DA,DC,DE,DG,DI,DL,DN,DP,DR,DT,DV,DX,Dc,De,Dg,Er,Et,Ev,Ex,Du,Dw,Dy,D1,D6,D8,D0,EB,ED,EF,EK,EM,EO,EQ,ES,EU,EZ,Eb,Ed,Ef,Eh,Ej,Ep,E4,E6,E8,E0,FB,FD,FH,FJ,FL,FN,FP,FR,FV,FX,AN,FZ,Fb,Fd,Ff,AP,Bq,Da,En,E2,FF,FT,AR,AT ;

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEFEEEAEEEVA

Entity 5 Entity 5 polymer

Description description	Tektin-2
Molecular weight formula_weight	50385.1 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,e,f,g,h,i,j,k,l,m

MATLSFKPSERYRLSDWRTNSYLLSTNAERQRDASHQIRQEARILRNETNNQIVWDEHDNRTRLAERIDTVNRWKETLDKCLTDLDAEIDSLAQAKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVRDPVEEELLKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTSPNISLKVNPTRIPKDSTTLQQWDEFTRFNKNRAEAEMKASIELREAIALAIAQTNNELDAQRVATEFTFRKRLREMESFYSELKWQEKNTLEEIAELQGDIRRLEEDLRRKMMNLKLAHTRLESRTYRSNVELCRDQTQYGLIDEVHQLEATINTMKQKLAQTQNALDALFKHLARIQADIACKTNTLLLDTKCMDTRRKLTVPAEKFVPQVDTFTRTTNRTLSPLKICQLELT

Entity 6 Entity 6 polymer

Description description	EF-hand domain-containing family member B
Molecular weight formula_weight	95892.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2

MCSFVRVGSPKPLQTSASPLEMSSLRRTRAPEISELGLTPEQKDDIRDRVLRGSKSPTELGFDLRLEQDRKWRERMGSSEAKSPPCHALGVGLERHTISGTPTEMGNLGLHKGSAFQGSKPLGVLPGRVGPENKGLPPRLRYGGTLHPPFSTVHASPLAAESRRRPLAWGSAWTDAVVEKQPVVGLELRKEPEKEPTCVVMNPYPEMPPKEVDIGLPQTQESDEAKNTEPLIGLVREPSECPFAQQPEEKKEPGSTEPGVEPPGNIRPIYSGKFFDRVPCWPSAGKVKPVGYRVATCLTEKLPRLMTPPEAKKYFNFRYPPAGAERVFYGRANDPQIAPYLTHGLRSKISIPMGSLINPQPITTFQQKIKDKKESIYFSHQRAPLGKSHDQTPGLPKGMDVINTTLGTPTIRELSVRDTVNPSKSFEDVLKEGQEGHDLYTVSHNDYFAGEAKNRKYNPASFHRFNLYGIPTPHFNDGRTMAKALHWLHELQMERGAKIVSKRVDDFKEKFQHKLGKVLDPIAETMNVPPGHTFGSCLHPEEYGAGDLIHYRSPDEYLRGKDHQRAVVAAARHHLKKFNHQNFDTLQVAFRHYDKKGDGVIDRAELHEACVQANLHLDKMLLDHLFDYCDVDQDGLINYLEFANFLNWKDRIPLKEHEKRVVVKGKKPDCENVTDTSMGEAEPSLLINPEDIVPKEPGSSEETLRTIQRPGDKVSHQYKTTSSEINAVVGAVPSMCHPIFGVPTIRSDISAPRIRRVSDMNNYGDEGNAYSLLHPSIFSQKGVFERDFFKTRSKEEISDILTNIGVKLSKEEFENVWNLASKKHQRGEVCVETIRNVLDELLHADLVKCKTAM

Entity 7 Entity 7 polymer

Description description	Tektin-3
Molecular weight formula_weight	56754.8 kDa
Source method src_method	nat
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AC,AD,AE,AF,AG,AH,AI,AJ,AK,BI,BJ,BK,BL,BM,AL

MELLGSTLTATYAHPPPASASFLPAIGTITSSYKDRFPHRNLTHSLSLPWRPNTYYKTAYNYPTLAPYSSRSQRVCESTMLPFVSNRTTFFTRYTPDDWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSYPSTLRLVGYC

Entity 8 Entity 8 polymer

Description description	Meiosis-specific nuclear structural protein 1
Molecular weight formula_weight	60353.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,A

MATKKRALSFSEKHQKLVDEKFRKSLNIQVMNKLERQAKNQVVQNENDEKVERQRFLRVLQNEQFELDMEEAIQKAEANKMLRDRQLEQEERLANELARLKHESLKDKKMRQQVRENSIELRELEQKLKAAYMNKERAAQIVEKDAMKYEQMKRDAEIERIMMEEHDRLLKEESAKQERRNKERAQYYLDLEKQLEDQERRKQEAYEQLLKEKLMIDEIVRKIYEEDQVERQQKLEKKNAIQKYIEEFQRAQDFWRQKKREEMEEENRKIIEFANIQEQREGERMARVHEIEEKRVQRQNLLMKQLEETLRQRDDLEQVRQELYQEEQAEIIKLKVKEEAELRLRRQREMKQDFEDQMALKELILQAAKEEEETFKKAMLAKFAEDDRIELMNAQKQRMKQLEHKRAVEKLIEERRSQFLADKQRELEELQLQQRRQGCINEIIEEERLRLLKEHAAKLLGYLPKGVFKREDDVDMLGEEFRKAYQKRDGV

Entity 9 Entity 9 polymer

Description description	Tektin-4
Molecular weight formula_weight	52121.4 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa,Ab,Ac,Ad,Af,Ag,Ah,Ai

MAQTGVLLTKEPAPQSIDVCELPRKEYEVACNTGAYTSSGLATAGFRTAKYLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRYPSVLQLAGYQ

Entity 10 Entity 10 polymer

Description description	Cilia- and flagella-associated protein 53
Molecular weight formula_weight	62036.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,4

MYSQQFGTVPREFKGPTPKAVIIRAKPPKAQRAEQHLKRIQRSYHKYHTTLASIKSNEENRLKCDWIQRNNHKTFDSLVQARVQDAMQGFVINTEERRNKLRELLASEENEYFSEMQLKGETIEEKKDKMRERTKLLREKKEKERQEFVAEKLDQQFRERCEELRTKLASIHEKKVVEERNAQIEFNKELKRQKLVEEHLFARLWEEDRLAKERREAQEEKRQRELVQNTRLGLDAQVTSIQAQRQGARRMKEEEARILEQNKAQIKREDEQEKLQKQKRRQETRSSLKKAVQDKIESMQREYREDLDLNMKLVGRALQDLQDEADKKKQKREEMGREQKIYNDYLMQRREEEKAQEKELNRLLEDIKAKKLAEKDRELALQRAARKQLMNEVMNTRKLQVQERLQRKLREQEELALHEQRISESLKVLHQEDMEDFARRCALAEEYRNQLQMQIAHQQQAREAEKEEERQEFEAGLAANKACLDKIQRILSENQALSQNVHPMRRGYPDKPPL

Entity 11 Entity 11 polymer

Description description	Tektin bundle-interacting protein 1
Molecular weight formula_weight	23987.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Az,A1,A2,A3

MENVRREATRPSVPSGTLELYFPDHLYRNDYVSLEGPRWAPAIKQAVRWKFTPMGRDAAGQVWFTGLTNSEPGDAWYKLPRALDTPYREAHTRWHGCFQSRQRGLPPAYTQHLREMAFWDPAITAQYLNSGPRWGCMQWRDRQIRGKEFVVTRNQFGAKLPWRSDYVPLLSLPQRPRFTAQDFRQRGLQRPCPAIGQPPPAFTPAL

Entity 12 Entity 12 polymer

Description description	Cilia- and flagella-associated protein 141
Molecular weight formula_weight	12278.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB

MSAEKMTKLEENLQRAVALKKTVDRWRNFHIHCMWQTTLDQRRNLFAALRMKDTKEQELALSNKQLLVVRQAALHELFEKEYQQYQQELNQMGKAFYEERL

Entity 13 Entity 13 polymer

Description description	Nucleoside diphosphate kinase 7
Molecular weight formula_weight	44489.8 kDa
EC 编号 ec_number	2.7.4.6
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,6

MRACQQGRSSSLVSPYMAPKNQSERFAFIAEWYDPNASLLRRYELLFYPVDGSVEMHDVKNRRTFLKRTKYEDLRLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDHHSRPFYNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFGTDGVRNAAHGPDTFASAAREMELFFPSSGGCGPANTAKFTNCTCCIIKPHAISEGMLGKNLIAIRDACFGMSAIQMFNLDRANVEEFYEVYKGVVSEYNDMVTELCSGPCVAIEIQQSNPTKTFREFCGPADPEIARHLRPETLRAIFGKTKVQNAVHCTDLPEDGLLEVQYFFKILDN

Entity 14 Entity 14 polymer

Description description	Protein FAM166B
Molecular weight formula_weight	30290.3 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B6,CL,Ca,Cq,C6,DK

MAVVNTSIPGLSGENPHYIPGYTGHCPLLRFSMGQTYGQVTGQLLRGPPGLAWPPAHRTLLPPIQSPRSPVISKGRLPPRRGHERLSSSIIPGYTGFIPRAQFIFAKNCNQVWAEAMSEFTRRHGEQESHQLPDGAKGEREVEEDQLREAEEPPLKQELAHASPYSMDDTDPHKFFMSGFTGYVPRARFLFGSSFPVLTNQALQEFGQMCSRGRAHKDPKPLSPLPRPTFQNLGLLPHYGGYVPGYKFQFGGTFGHLTHDALGLSITQKQLPA

Entity 15 Entity 15 polymer

Description description	Sperm-associated antigen 8
Molecular weight formula_weight	50591.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AZ

METTESTEGSLSRSCDVQPSSERLDTPSEPVPSSSSSPRSTAPAEAPAQYSVLTEPSSDSLYGAPCPPAHHRGHGFGFQPFYVSCIPQDPCNMADLSSRADPTSSYPCHSSVHGSGSGTCGLGQSSEPSQGSGPTSGPAPASVPSLVSGPDSASGPDSSASGPALASGPGPADPGQGPKFSTCIPQGYRCIPVDLAPDYNAWCQHLHWKPQRSWEPLQVSEPGVRGPYKPPEPGALGPCEPCEPCEPPEAESEETLCKARPRGQCLLYNWEEERATNQLDQIPPLQDGSESYFFRHGHQGLLTTQPQSPMSSSTTQRDSYQLPRHICQPLRGKREAMLEMLLRHQICKEVQAEQEPARKLFETESVTHHDYRVELVRAAPPASTKPHDYRQEQPETFWIQRAARLPGVSDIRTLDTPFRKNCSFSTPVPLSLGQPLPYELESGPHQVGVISSLACQGGGQGCGRTKTTPI

Entity 16 Entity 16 polymer

Description description	RIB43A-like with coiled-coils protein 2
Molecular weight formula_weight	45328.2 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Do,DZ,D4,EI,EX

MEVAMSKDLQQEANLAKKRYIDLCRQGRIFDARNRIIGGDTQAWDFQVRDQKIKEITDKARHEAFAAEMKHNDKVMCMAHDREQRHRKQLCRAINDFQQNFQKPETRREFDLSDPLALQKELPARISDNDMRNTISGMQKFMGEDLNFQERRRFQKEQSREWFLQQHGEREKARADHLLAEHLHTQTRLKFDETARELMKLEGSTRKEVCAAVKAFNKNQVVELTERKRQEKQQEQEDNMTEITNLLHGDLLSENPRPVASSFGSHRVVLDRWKGMNREQLEEIWFTQKRQIQEKLRLQEEERQHSMDWDLRRIRKAHASLLHERQQQRLLREQRRALDCSNLNLARQQYLQKKQMNTASSSQPTEDYFSQFNTRSR

Entity 17 Entity 17 polymer

Description description	Cilia- and flagella-associated protein 107
Molecular weight formula_weight	23062.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	8,9

MAMLSTSVVPEAFSTPGWQIEKKYSTKVLLGNWVEERGKFTKAIDHTPQCIYRKEYVPMPDHRPDFVSRWYSKSKMEGLPYKHLITHHQEPSHRYLISTYDDHYNRHNYNPGLPALRTWNGQKLLWLPEKSDFPLVAPPTNYGLLEQLQQKWLASKTSLKESIYTTSYPRLPVCAMSRREHAIPVPHPRLQPIPRF

Entity 18 Entity 18 polymer

Description description	Cilia- and flagella-associated protein 161
Molecular weight formula_weight	34433.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ay,BH

MAQNVYGPGVRMGNWNEDVYLEEERMRHFLEKREKGELLIQRNRRVKKNILRPMQLSVSEDGYVHYGDKVIIVNPDQVLGEEAGKFMRGDLSLCMSPDEVKAQLSDDLEIPCGVSAVQTIAPMGRNTFTILSDGANSCEMGQVVVYGQNFCLGIAAGLEGKMLYLTSDHRTLLKSSLKSGLQEVTLTDEVTHLNCWQAAFLDPQLRLEYEGFPVRANEKIVIYHRHTNRALAVHRNLFLRTYFGKEMEVVAHTYLDSHKVEKPKNQWMLVTGNPRNKSNTMLDISKPITEDTRALEQAMGINT

Entity 19 Entity 19 polymer

Description description	EF-hand domain-containing protein 1
Molecular weight formula_weight	75235.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E1,Em,FE

MGTNPVHGLPFLPGSSFTDSTKTAFHRSQTLNYRNGYAVVRRPTMGIGGDRLHYNQLSQAELDELANKAPILTYGPLKQAPLAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDHYHWKDLNRGINLTVYGKTFRIVDCDRFTQDFLESQGIELNPSEKIPLDPYTQLRKEPVRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVLVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFGMPDLPPVDVTKKEPPPVKQELPPYNGYGLIEDSAQNCFALIPKAPRKDVVKMLMNDNKVLRYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVDNPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIQKPELPAPELESKQATGEPMVQGTEESKVQDLDALIDQIHMHLKYNSYKENLRETFQMYDKDESGYVDRETFFKICETLNVPVDDSLIKELIRLCTHGEGRINYYNFVRAFSN

Entity 20 Entity 20 polymer

Description description	Sperm acrosome-associated protein 9
Molecular weight formula_weight	19512.4 kDa
Source method src_method	nat
Copy count entity_count	27

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F1,F2,F3,F4,F5,F6,F7,F8,F9,F0,GA,GB,GC,GD,GE,GF,GG,GH,GI,GJ,GK,GL,GM,GN,GO,GP,GQ

MNEVKESLRSIEQKYKLFQQQQFTFIAALEHCRENAHDKIRPISSIEQVQSYMEHYCNNSTHRRILIMFMDICSELSKLCQHFEALHSGTPVTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLIPIVLDFMKEWIAHSEKLPRKVLQHGTT

Entity 21 Entity 21 polymer

Description description	EF-hand domain-containing family member C2
Molecular weight formula_weight	87758.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Fg,FS,Fo,Fv

MALPFLPGNSFNRNIGKERFHKSQHWGFCNNVRMLVSENKPGVGGDLLYGQKIKPKHSVFPKGDGTDAPSWVAFDKQVLSFDAYLEDEISDKRQEIFRIRYYKIYFYLEDDTIQVNEPEVINSGLPQGTSIRRQRIPYPPPNDDQFYTVYDFNINISVVFYGRTFKIYDCDPFTKNFLKKIGIKLNPPGQCPLDPYMKMRRETLEFVDPFRPYQSFDTLKRFIQYDGKVLRFFCLWDDSTSLFGDRREFVLHYFLCDGTVEIREVLPSNSGRDAMSSFLRRGKLPKYGPPGIYQPGQITDRAVLNVYGGLSEWRADGYLLDKYQLGKVEQDFYTDQDLSIGATINVWGRKVLLCDCDEFTKTYYRTKYGVDNFTPISCKPPHLPKIERKYPPYTGFGSEEDSFRSCVGLKPTPHRKNFKKFMELDSFGNISNILRYFGKLITHKCADVDRIFVIAFYLSDDTISVFEPIENNSGNAGGMFLKRSRVKKPGQEVFKSEFSEYIKAEELYIGATVNINGYLFILLNADEYTLNYMENNTDKFPYSNFELAIQKLKQEKSKSREITQVFAAADYNHTKVVPYNTFRDILMSITMGKLIDQELITIARHYRVPEIMDPDLAYLIARAHEKFKKNIFENFDMFIYNCVYEDREKKGVLPTKDIRRMCKSSRLPLDDDFLDCLLSRFEDKDHQINYEIFFSVLNWRMNPTPDLQAPPYLKEKCEDVWVGMPSPIPVKYVRYLDFLIDVYGLEDNML

Entity 22 Entity 22 polymer

Description description	Cilia- and flagella-associated protein 20
Molecular weight formula_weight	22781.4 kDa
Source method src_method	nat
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Fh,Fi,Fj,Fk,Fl,Fm,Fn

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Entity 23 Entity 23 polymer

Description description	Parkin coregulated gene protein homolog
Molecular weight formula_weight	27763.3 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Fp,Fq,Fr,Fs,Ft

MPKRTKLLPQQTFQVHQPRSLVSEGFTVKAMMKNSVVRGPPVAGAFKERPAKPTTFRKCYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLSEMTFPYEFFARRGIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQIICVTLKVLQHLVVSSEMVGEALLPYYRQILPILNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGEDAFINIKYMVPTYESCLLN

Entity 24 Entity 24 polymer

Description description	Dual specificity protein phosphatase 3
Molecular weight formula_weight	20494.1 kDa
EC 编号 ec_number	3.1.3.16,3.1.3.48
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Fx,Fy,Fz

MSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVVPRVYVGNASVAQDITQLQKLGITHVLNAAEGRSFMHVNTSASFYEDSGITYLGIKANDTQEFNLSAYFERATDFIDQALAHKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSTVRQNREIGPNDGFLAQLCQLNDRLAKEGKVKL

Entity 25 Entity 25 polymer

Description description	Piercer of microtubule wall 2 protein
Molecular weight formula_weight	13728.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MARETDCDLDKKTSLTSDAEMRPEPPALCVNPGNPVFSCMLDPKTLHTATSLSKAQMIMYKTSASQYGAFSPRPFFFPCKFLPQEQAFTEHLKTTGFYQNNSLNVGPDRTRTIDSPNYQHTL

Entity 26 Entity 26 polymer

Description description	Tektin-5
Molecular weight formula_weight	62817.5 kDa
Source method src_method	nat
Copy count entity_count	23

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	GR,GS,GT,GU,GV,GW,GX,GY,GZ,Ga,Gb,Gc,Gd,Ge,z0,z1,z3,z4,Gf,Gg,Gh,Gi,Gj

MEFLGTTQTASFCGPKKGCGLQALPPAGQEPVVQECYQPFHLPGYRYLNAWRPSVFHKIATSQTIPEECSGIRRPPTILPSLRSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFRLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKSRLEHELAIKANTLCIDKDKCMSMRKSFPSTPRLTGYTCSAIGSGPYANHAPRISSGPCSGSALCKGPASCGGGASCGGGASCGGHAPCGSALCSHSVSRSGPGFAPVC

Entity 27 Entity 27 polymer

Description description	Cilia- and flagella-associated protein 45
Molecular weight formula_weight	65962.0 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,AA,c,Ax,d

MPLRPGDASSSASTASNRSRTRTRYRTKAMNSEVDESLFGGVKPSSQGKSDSPIVVIHDKHAIRKTLSALGLEHKTETIQLITRDMVRELIVPTEDPSGESLIISPEEFERIKWASQVLTKEELNAREQALKKEKEGILEAVTIRKKIMKQKEMTWNNNKKLSDLEEVARERAQNLLQRADKLRMEQEEELKDMSKIILNAKCHAIRDAQILEKQQIQKELDEEERRLDHMMEIDRRESLQRQEDRERKRREERVRGKRHIVEQIKKNEEERSLQAEHREQEKEQMLAYLDRLQEEDLQDLERRHQEKLKMQAEIKRINDENQRQKAEMLAQERLADQMVMEFTKKKMAREAEYEAEQEKIRREKEKEIARLRALQEKAQDYQAEQDALRAKRNQEVADREWRRKEKENAQKKIETEEKLRKSRLEQVAFKEHTLAVQVQRDRDEFERILRAQREQIEREKQEQEKKAKGCLQHANELRRQVRENQQKHVQNRLATFEEGRRLKEEAEKRRERIEDIKKQKLEELRATGLPEKYCIEVERKANILPATSVN

Entity 28 Entity 28 polymer

Description description	Cilia- and flagella-associated protein 52
Molecular weight formula_weight	68322.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	BG,Ba,Bo

MEEQVLPELDVAELELQAVIGFNGHVPNGLKCHPDQEHLIYPLGCTVLIQAINTNEQNFLHGHGNNVSCVTISKEGDYIASGQVTFMGFKADIILWDFKKRELIARLSLHKGKIEALAFSPNDLYLVSLGGPDDGSVVVWSIAKRDAICGSPAAGLNVGNATSVVFSRCRDEMFVTAGNGTIRVWELDLPNRKIWPTECQTGQMKRIVLSTGMADDDSFFYLGTTTGDILKMNPKTKLLADTGPVKDKFSLGVSALRCLKMGGLLVGSGAGLLIFCKSPSYKPIKKVQLQGGITSITLRGEGHQFFVGTEESHIYRVNFTDFKETLIATCHFEAVQDIVFPFGTAELFATCAKKDIRVWHTMSKRELLRITVPNMTCHGIDFMRDGKSIISAWDDGKIRAFAPESGRLMYTINSAHRIGVTAIATTSDCKRIISGGGEGEVRVWQVGCQTQKLEEALKEHKSSVSCIRVKKNNEECVTASTDGTCIIWDLVRLRRNQMILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGSVIRELEGSLSGSINGMDITQEGGHFVTGGHDHLVKVWDYNEGEVTHVGVGHSGNIMAMRISPGNQYIVSVSADGAILRWKYPFAS

Entity 29 Entity 29 polymer

Description description	Enkurin
Molecular weight formula_weight	29587.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B5,CK,CZ,Cp

MDSPCTSESIYNLIPSDLKEPPQHPRYTSLFRATIKNDMKKFKTAMKTMGPAKVEIPSPKDFLKKHSKEKTLPPKKKFNRCSPKKPAVPLRTDHPVMGIQSGKNFINTNAADVIMGVAKKPKPIYVDKRTGDKHDLETSGLFPKYINKKDYGITPEYICKRNEDVKKAQEEYDNYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSVPKKIRKQKLEKEMKQLEHDISVIEKHKIIYIANK

Entity 30 Entity 30 polymer

Description description	Protein Flattop
Molecular weight formula_weight	20575.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C5,DJ,DY

MATNYSANQYEKAYLPTYLQNWSPARPTKEKIAAHEGYTQIIANDRGHLLPSVPRSKASPWGSFMGTWQMPLKIPPAKVTLTARTTTAADNLTKWIHKNPDLLNACNGLRPEISGKPFDPDSQTKQKKSVTKTVQQAPNPTIIPSSPVIQGDNPDEPQSSHPSAGHTPGPQTPVNSPNNPPPSPCKSTK

Entity 31 Entity 31 polymer

Description description	Cilia- and flagella- associated protein 210
Molecular weight formula_weight	65266.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Dn,D3

MQVRFGRRSGQAKESQGMDCFEKEEIPYPPLLPSKVDLQQITIIPHAEWERIRDSLNRLTREAAVLRAERAAKKKMHVKSQELVKHWTNTYAGMKEQKLKAKQKRDEEIEAERKVLDLEEEIYKEGERKKAIESARQCQFHQTERVKRFHSGLLLSRVMKERDVQIQYKKNAVKSDKKWEEQVKLNDEKAFKEDQEKEEKRRRERVALAEDHLKQIEEHKEEEEARKKSEEKDAEEMKRQNLLYEIEMKKNLSKKQEEIDTNRKLLLDNMHNKNIIRAVEQQQQEEEDEKIRKFIKAKKRLIQMRMDKDAETHRLMEERRERINNFLSKLIKEKLDTEDLIIARDISEADAELEKREKEKHEKNQADLKAIAEYRASVMKNKEEEERQRKIEAKEQLQAVLKADKIFQELEKEKSLKVTREKLEIQDAHIQQIAINKYNAKQMKEEELDYWRLTDALTVEKEKEFEKYAREVINFESESTKKYAYPMVKAVQEGVGGGRGPPFVGRGGIRPSYQATDATGVQLPCFKSQGSKYNDFQKSKRRLGFTW

Entity 32 Entity 32 polymer

Description description	Cilia- and flagella-associated protein 276
Molecular weight formula_weight	18960.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	EH,EW,El

MLQPQETFSNPALRDEDKHLGNLWASKKSLYKNPAHLAQQQDPWSRLSSTPTATSRSRDTFFDSKIPKDDLDFRLATLYNHHTGAFKNKTEILLHQETIEDIQGTKIQFPGECFHAPSAPITSRTTIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKNDGGFFST

Entity 33 Entity 33 polymer

Description description	EF-hand calcium-binding domain-containing protein 6
Molecular weight formula_weight	176028.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ez

MKRNGTRLNFAKANSTKSGSTRARDLMNKMSIIPEWHSLYSNTRKLPCSRPHSSPCKMQRTIFQDLCRPSSSTTAIANPVLSYLDIERILAQKISSRRDDIKKVFQILDRNHNQMVTKGDLKRVITAFLIPLTKDQFQDLLAQIPISSLGNVPYLEFLSRFGGGIDININGIKRVNENEVDNRRTVKEVQLTEKIFRNMRSIRKVFQVMDVNNTGLVQPQELRRVLETFCLRMQDGDYEKFLEQYNIDKTTAVDYNAFLKNLSVKNDASFKYLLSNAAELSRETQQGKNGKRLLDTGSSEDVWKNYSLDDLEKTFCQEFSKSYEKIEKALSAGDPSKGGYISLNYLKVVLDTFIYRLPRRIFIQLIRRFGLKTSTKINWKQFLTAIYERQKLEVSKTLPLKKRSSTEARNRSRKENIIKKLFKYSEDRYTALKKTLLIISSTPSGHITWEELRHILNCMVAKLNDSEFSELKQTFDPEGTGAVRVNSLLDVLDDSTKVRKMSPSTDTKTPLPVAWDSVEELVLDSITRNLQAFYSMLQSYDLRDTGTIGKNNFRKVMRVFCPYLSNEHLVRFSSKFQEAGSGRILYKKFLLSIGVGIPPPTPPLSSPKVQLSDQFQIEEPGQQDERTQPSGEKTSEINNMTKEEVIDGLKHRIQQKDPVFRKQFLSISKEPDVKINQEEFRKVLERSGMPMNDCQYAMLASKLGFKNEEGMSYQDFTMGFEDCMLSGLETVPLQSRTASRTNMDEHFISAEECLRIFPKKLKESFRDVYSAFFRIDLDRDGIISMHDFHRLLQYLQLNMVDLEFERFLSLLGLRLSVTLNFREFQNLCEKRPWKSDEAPQRLIRCKQKVADSELACEQAHQYLIMKAKTRWADLSKNFIETDNEGNGILRRRDIKNSLYGFDIPLTPREFEKLWQNYDTEGRGYITYQEFLHRLGIRYSPKVHRPYKEDYFNFLGHFTKPKQVQEEIQELQQISEREKLMNHYEEISKAFNAMEKSKPVALCRVQKVLQECGCPLKEEELISLLKSLDVSVHNNHIDPVEFLRALEISWASKARPKEKEESSPPPISFSKVTPDEVIKTMQEVVESSQPALVEAFSALDKEDTGFVKAMEFGDVLRSVCQKLTDNQYHYFLRRLRLHLTPNIHWKYFLENFSTFQDETADDWAENMPKAPPPMSPKETAHRDIVARVQKAVASHYHTIVQEFENFDTLKSNTVSRDEFRSICTRHIQILTDEQFDRLWSELPVNAKGRLKYQDFLSKLSIERVPSPPMAAGDSGESTMAQRGSSAPEFSQGTRSNLYSPPRDSRVGLKSRSHPCTPVGTPPLQNCEPIESRLRKQIQGCWRELLRECKEKDTDKQGTISAAEFLALVEKFKLDISREESQQLIVKYDLKNNGKFAYCDFIQSCVLLLKAKETSLMRRMRIQNADKMKEAGMETPSFYSALLRIQPKIVHCWRPMRRSFKTYDKNGTGLLSVADFRKVLRQYSINLSEEEFFHVLEYYDKSLSSKISYNDFLRAFLQ

Entity 34 Entity 34 polymer

Description description	Coiled-coil domain-containing protein 105
Molecular weight formula_weight	57406.5 kDa
Source method src_method	nat
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,E,F,H

MPVLLPSTDPGQDSRVGAPEWRQAAKATSRKAHLLTDRCGQEAVTMWQPKDSVLDPNVAHHLGRAAYMEPWRFRVEMLKGGGTLEKPPPGEGVTLWKGKMKPPAWYARLPLPMHRDARAQQTAEVVHAHARGARLTAARLGRAQHQINGQLRLLLRQREATDRRLSEVRKGLLINQQSVKLRGYRPKCEKIPDKADSLLVWEKKELKSMKRKMEKDMEISEDLLKALASCRDTLDFYCQERLQAVELMNQPLDKVLEQAGRHSWVDITRPPTPRTQGLKTPPPDPIGTYTPACAKALFEAKRLLMESKDILTEMAKNEVDIQNQQQEISNRVCSSLAQKMRETLELKERMTMTLGLMRGTIHRCMKFNQEMYVTRGIIKGPLLKRNLEAREKLNRPLVRMYQRHVGTQLPEATRLAQGTDLLTRHNLHMEKNLKELRTTHDNLAWGLNCKKIGHDVDYDVVRLRLRQRHPHVCYEQAQRLVNDWDPPTPARSQTNTASK

Entity 35 Entity 35 polymer

Description description	Piercer of microtubule wall 1 protein
Molecular weight formula_weight	18862.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Fw

MSEEKPQQSAEEPEPGEPKAKPAPEEPEPGEPKAKPAPEEPEPGEPKAKPAPEKTSDYYRISEKLPVRFNNPGWFHGYGTKEAVSMYRTSNQTYGSRAPTVHEMPKVFYPSSNKFSRQHAAFGMFQSHNINVTLEKSLVTGPDNHITHYDRLNFHPSYNVNRPSICD

▶

Resolution resolution	7.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	12848

48-nm repeating structure of doublets from mouse sperm flagella

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cilia- and flagella-associated protein 95

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Detyrosinated tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta-4B chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EF-hand domain-containing family member B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Meiosis-specific nuclear structural protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tektin-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cilia- and flagella-associated protein 53

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer