SAXSdb — 8ixa

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin alpha-1A chain

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Tubulin beta-2A chain × 9 （Q7TMM9） Kinesin-1 heavy chain × 9 （P33176） GUANOSINE-5'-TRIPHOSPHATE × 9 PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ADENOSINE-5'-TRIPHOSPHATE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1A_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–457； UniProt 1–451 Author chain B； PDBConstruct 1–457； UniProt 1–451 Author chain C； PDBConstruct 1–457； UniProt 1–451 Author chain D； PDBConstruct 1–457； UniProt 1–451 Author chain E； PDBConstruct 1–457； UniProt 1–451 Author chain F； PDBConstruct 1–457； UniProt 1–451 Author chain G； PDBConstruct 1–457； UniProt 1–451 Author chain H； PDBConstruct 1–457； UniProt 1–451 Author chain I； PDBConstruct 1–457； UniProt 1–451

Tubulin beta-2A chain

Mus musculus

UniProt Q7TMM9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Tubulin alpha-1A chain × 9 （P68369） Kinesin-1 heavy chain × 9 （P33176） GUANOSINE-5'-TRIPHOSPHATE × 9 PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ADENOSINE-5'-TRIPHOSPHATE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB2A_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 1–445； UniProt 1–445 Author chain K； PDBConstruct 1–445； UniProt 1–445 Author chain L； PDBConstruct 1–445； UniProt 1–445 Author chain M； PDBConstruct 1–445； UniProt 1–445 Author chain N； PDBConstruct 1–445； UniProt 1–445 Author chain O； PDBConstruct 1–445； UniProt 1–445 Author chain P； PDBConstruct 1–445； UniProt 1–445 Author chain Q； PDBConstruct 1–445； UniProt 1–445 Author chain R； PDBConstruct 1–445； UniProt 1–445

Kinesin-1 heavy chain

Homo sapiens

UniProt P33176

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	Tubulin alpha-1A chain × 9 （P68369） Tubulin beta-2A chain × 9 （Q7TMM9） GUANOSINE-5'-TRIPHOSPHATE × 9 PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ADENOSINE-5'-TRIPHOSPHATE × 9	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KINH_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain S； PDBConstruct 24–372； UniProt 1–349 Author chain T； PDBConstruct 24–372； UniProt 1–349 Author chain U； PDBConstruct 24–372； UniProt 1–349 Author chain V； PDBConstruct 24–372； UniProt 1–349 Author chain W； PDBConstruct 24–372； UniProt 1–349 Author chain X； PDBConstruct 24–372； UniProt 1–349 Author chain Y； PDBConstruct 24–372； UniProt 1–349 Author chain Z； PDBConstruct 24–372； UniProt 1–349 Author chain a； PDBConstruct 24–372； UniProt 1–349

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ixa
Deposition date deposition_date	2023-03-31
Structure title title	GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin non-seam region
Keywords keywords	microtubule, tubulin isotype, cryo-EM structure, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ixa__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ixa__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ixa__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	87.84 Å
Rg (electron density)	88.13 Å
Total Rg	88.07 Å
Atom count	84087
Residues	10602
Excluded volume	1484500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ixa__assembly_1__model_1`	27-meric （27）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Tubulin alpha-1A chain
Molecular weight formula_weight	51017.3 kDa
EC 编号 ec_number	3.6.5.-
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,A,B,C,D,E,F,G,H
Atom count atom_count	84087

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIHHHHHHGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Insecta environmental sample

Entity 2 Entity 2 polymer

Description description	Tubulin beta-2A chain
Molecular weight formula_weight	51151.0 kDa
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,J,K,L,M,N,O,P,R

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEAGGSGGDYKDDDK

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Insecta environmental sample

Entity 3 Entity 3 polymer

Description description	Kinesin-1 heavy chain
Molecular weight formula_weight	41721.1 kDa
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,S,T,U,V,W,X,Z,a

MGSSHHHHHHSSGLVPRGSHMASMADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSAKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 5 Entity 5 non-polymer

Description description	PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER
Molecular weight formula_weight	521.2 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 6 Entity 6 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	9

▶

Resolution resolution	4.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	19287

GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin non-seam region

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Tubulin beta-2A chain

State in the Current Structure

Other States of the Same Protein in the Database

Kinesin-1 heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ixa__assembly_1__model_1

8ixa__assembly_1__model_1 | I(q)

8ixa__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin non-seam region

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta-2A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Kinesin-1 heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ixa__assembly_1__model_1

8ixa__assembly_1__model_1 | I(q)

8ixa__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)