8ixa

GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin non-seam region

Method: ELECTRON MICROSCOPY D_max: 232.7 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin alpha-1A chain

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain A； UniProt 1–451 Chain B； UniProt 1–451 Chain C； UniProt 1–451 Chain D； UniProt 1–451 Chain E； UniProt 1–451 Chain F； UniProt 1–451 Chain G； UniProt 1–451 Chain H； UniProt 1–451 Chain I； UniProt 1–451	Not recorded	Tubulin beta-2A chain × 9 （Q7TMM9） Kinesin-1 heavy chain × 9 （P33176） GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 6.9 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8IXA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8IXB GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–451（451 aa） Chain E 1–451（451 aa） Chain F 1–451（451 aa） Chain H 1–451（451 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8TO0 48-nm repeating structure of doublets from mouse sperm flagella Deposited 2023-08-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 471 PDB declaration: 471-meric	Chain A5 1–451（451 aa） Chain A7 1–451（451 aa） Chain A9 1–451（451 aa） Chain AM 1–451（451 aa） Chain AO 1–451（451 aa） Chain AQ 1–451（451 aa） Chain AS 1–451（451 aa） Chain AU 1–451（451 aa） Chain AW 1–451（451 aa） Chain AY 1–451（451 aa） Chain Aj 1–451（451 aa） Chain Al 1–451（451 aa） Chain An 1–451（451 aa） Chain Ap 1–451（451 aa） Chain Ar 1–451（451 aa） Chain At 1–451（451 aa） Chain Av 1–451（451 aa） Chain B0 1–451（451 aa） Chain B2 1–451（451 aa） Chain B4 1–451（451 aa） Chain B8 1–451（451 aa） Chain BA 1–451（451 aa） Chain BC 1–451（451 aa） Chain BE 1–451（451 aa） Chain BO 1–451（451 aa） Chain BQ 1–451（451 aa） Chain BS 1–451（451 aa） Chain BU 1–451（451 aa） Chain BW 1–451（451 aa） Chain BY 1–451（451 aa） Chain Bc 1–451（451 aa） Chain Be 1–451（451 aa） Chain Bg 1–451（451 aa） Chain Bi 1–451（451 aa） Chain Bk 1–451（451 aa） Chain Bm 1–451（451 aa） Chain Br 1–451（451 aa） Chain Bt 1–451（451 aa） Chain Bv 1–451（451 aa） Chain Bx 1–451（451 aa） Chain Bz 1–451（451 aa） Chain C0 1–451（451 aa） Chain C1 1–451（451 aa） Chain C3 1–451（451 aa） Chain C8 1–451（451 aa） Chain CB 1–451（451 aa） Chain CD 1–451（451 aa） Chain CF 1–451（451 aa） Chain CH 1–451（451 aa） Chain CJ 1–451（451 aa） Chain CN 1–451（451 aa） Chain CP 1–451（451 aa） Chain CR 1–451（451 aa） Chain CT 1–451（451 aa） Chain CV 1–451（451 aa） Chain CX 1–451（451 aa） Chain Cc 1–451（451 aa） Chain Ce 1–451（451 aa） Chain Cg 1–451（451 aa） Chain Ci 1–451（451 aa） Chain Ck 1–451（451 aa） Chain Cm 1–451（451 aa） Chain Co 1–451（451 aa） Chain Cs 1–451（451 aa） Chain Cu 1–451（451 aa） Chain Cw 1–451（451 aa） Chain Cy 1–451（451 aa） Chain D2 1–451（451 aa） Chain D5 1–451（451 aa） Chain D7 1–451（451 aa） Chain D9 1–451（451 aa） Chain DB 1–451（451 aa） Chain DD 1–451（451 aa） Chain DF 1–451（451 aa） Chain DH 1–451（451 aa） Chain DM 1–451（451 aa） Chain DO 1–451（451 aa） Chain DQ 1–451（451 aa） Chain DS 1–451（451 aa） Chain DU 1–451（451 aa） Chain DW 1–451（451 aa） Chain Db 1–451（451 aa） Chain Dd 1–451（451 aa） Chain Df 1–451（451 aa） Chain Dh 1–451（451 aa） Chain Dj 1–451（451 aa） Chain Dl 1–451（451 aa） Chain Dp 1–451（451 aa） Chain Dr 1–451（451 aa） Chain Dt 1–451（451 aa） Chain Dv 1–451（451 aa） Chain Dx 1–451（451 aa） Chain Dz 1–451（451 aa） Chain E3 1–451（451 aa） Chain E5 1–451（451 aa） Chain E7 1–451（451 aa） Chain E9 1–451（451 aa） Chain EA 1–451（451 aa） Chain EC 1–451（451 aa） Chain EE 1–451（451 aa） Chain EG 1–451（451 aa） Chain EJ 1–451（451 aa） Chain EL 1–451（451 aa） Chain EN 1–451（451 aa） Chain EP 1–451（451 aa） Chain ER 1–451（451 aa） Chain ET 1–451（451 aa） Chain EV 1–451（451 aa） Chain EY 1–451（451 aa） Chain Ea 1–451（451 aa） Chain Ec 1–451（451 aa） Chain Ee 1–451（451 aa） Chain Eg 1–451（451 aa） Chain Ei 1–451（451 aa） Chain Ek 1–451（451 aa） Chain Eo 1–451（451 aa） Chain Eq 1–451（451 aa） Chain Es 1–451（451 aa） Chain Eu 1–451（451 aa） Chain Ew 1–451（451 aa） Chain Ey 1–451（451 aa） Chain FA 1–451（451 aa） Chain FC 1–451（451 aa） Chain FG 1–451（451 aa） Chain FI 1–451（451 aa） Chain FK 1–451（451 aa） Chain FM 1–451（451 aa） Chain FO 1–451（451 aa） Chain FQ 1–451（451 aa） Chain FU 1–451（451 aa） Chain FW 1–451（451 aa） Chain FY 1–451（451 aa） Chain Fa 1–451（451 aa） Chain Fc 1–451（451 aa） Chain Fe 1–451（451 aa） Chain N 1–451（451 aa） Chain P 1–451（451 aa） Chain R 1–451（451 aa） Chain T 1–451（451 aa） Chain V 1–451（451 aa） Chain X 1–451（451 aa） Chain Z 1–451（451 aa） Chain n 1–451（451 aa） Chain p 1–451（451 aa） Chain r 1–451（451 aa） Chain t 1–451（451 aa） Chain v 1–451（451 aa） Chain x 1–451（451 aa） Chain z 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 7.70 Å
9PND In situ microtubule of EpoB-induced regenerating axons Deposited 2025-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–451（451 aa） Chain C 1–451（451 aa）	Not recorded	MG MAGNESIUM ION × 4 GDP GUANOSINE-5'-DIPHOSPHATE × 2 EPB 7,11-DIHYDROXY-8,8,10,12,16-PENTAMETHYL-3-[1-METHYL-2-(2-METHYL-THIAZOL-4-YL)VINYL]-4,17-DIOXABICYCLO[14.1.0]HEPTADECANE-5,9-DIONE × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2；Gibco Neurobasal Media cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.19 Å
9SFP Native cytoplasmic lattices from mouse oocytes Deposited 2025-08-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 54 PDB declaration: 54-meric	Chain a 1–451（451 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.20 Å
9XRL Structure of mouse cytoplasmic lattice (CPL) repeating unit Deposited 2025-11-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 73 PDB declaration: 73-meric	Chain AF 1–451（451 aa） Chain AO 1–451（451 aa） Chain u 1–451（451 aa）	Not recorded	ZN ZINC ION × 13 GTP GUANOSINE-5'-TRIPHOSPHATE × 5 MG MAGNESIUM ION × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 6.7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TBA1A_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–457； UniProt 1–451 Author chain B； PDBConstruct 1–457； UniProt 1–451 Author chain C； PDBConstruct 1–457； UniProt 1–451 Author chain D； PDBConstruct 1–457； UniProt 1–451 Author chain E； PDBConstruct 1–457； UniProt 1–451 Author chain F； PDBConstruct 1–457； UniProt 1–451 Author chain G； PDBConstruct 1–457； UniProt 1–451 Author chain H； PDBConstruct 1–457； UniProt 1–451 Author chain I； PDBConstruct 1–457； UniProt 1–451

Tubulin beta-2A chain

Mus musculus

UniProt Q7TMM9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain J； UniProt 1–445 Chain K； UniProt 1–445 Chain L； UniProt 1–445 Chain M； UniProt 1–445 Chain N； UniProt 1–445 Chain O； UniProt 1–445 Chain P； UniProt 1–445 Chain Q； UniProt 1–445 Chain R； UniProt 1–445	Not recorded	Tubulin alpha-1A chain × 9 （P68369） Kinesin-1 heavy chain × 9 （P33176） GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 6.9 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8IXA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
24MC Structure of oocyte cytoplasmic lattices Deposited 2026-03-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain W 1–445（445 aa） Chain Z 1–445（445 aa）	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 5 GTP GUANOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 4 ZN ZINC ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8IXB GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain Q 1–445（445 aa） Chain U 1–445（445 aa） Chain V 1–445（445 aa） Chain W 1–445（445 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8IXD GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin non-seam region Deposited 2023-03-31	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain J 1–445（445 aa） Chain K 1–445（445 aa） Chain L 1–445（445 aa） Chain M 1–445（445 aa） Chain N 1–445（445 aa） Chain O 1–445（445 aa） Chain P 1–445（445 aa） Chain Q 1–445（445 aa） Chain R 1–445（445 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8IXE GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain R 1–445（445 aa） Chain W 1–445（445 aa） Chain Z 1–445（445 aa） Chain a 1–445（445 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8IXF GMPCPP-Alpha4A/Beta2A-microtubule decorated with kinesin non-seam region Deposited 2023-03-31	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain J 1–445（445 aa） Chain K 1–445（445 aa） Chain L 1–445（445 aa） Chain M 1–445（445 aa） Chain N 1–445（445 aa） Chain O 1–445（445 aa） Chain P 1–445（445 aa） Chain Q 1–445（445 aa） Chain R 1–445（445 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8IXG GMPCPP-Alpha4A/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain R 1–445（445 aa） Chain W 1–445（445 aa） Chain Z 1–445（445 aa） Chain a 1–445（445 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
9W2M Cryo-EM structure of the Cytoplasmic lattice(CPL) from mouse oocyte Deposited 2025-07-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 56 PDB declaration: 56-meric	Chain L 1–445（445 aa） Chain l 1–445（445 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 4 ADP ADENOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TBB2A_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 1–445； UniProt 1–445 Author chain K； PDBConstruct 1–445； UniProt 1–445 Author chain L； PDBConstruct 1–445； UniProt 1–445 Author chain M； PDBConstruct 1–445； UniProt 1–445 Author chain N； PDBConstruct 1–445； UniProt 1–445 Author chain O； PDBConstruct 1–445； UniProt 1–445 Author chain P； PDBConstruct 1–445； UniProt 1–445 Author chain Q； PDBConstruct 1–445； UniProt 1–445 Author chain R； PDBConstruct 1–445； UniProt 1–445

Kinesin-1 heavy chain

Homo sapiens

UniProt P33176

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 27 PDB declaration: 27-meric（27） Consistent with protein copy count	Chain S； UniProt 1–349 Chain T； UniProt 1–349 Chain U； UniProt 1–349 Chain V； UniProt 1–349 Chain W； UniProt 1–349 Chain X； UniProt 1–349 Chain Y； UniProt 1–349 Chain Z； UniProt 1–349 Chain a； UniProt 1–349	Not recorded	Tubulin alpha-1A chain × 9 （P68369） Tubulin beta-2A chain × 9 （Q7TMM9） GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer：pH 6.9 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 4.20 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8IXA	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1BG2 HUMAN UBIQUITOUS KINESIN MOTOR DOMAIN Deposited 1998-06-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–325（325 aa） Fragment：MOTOR DOMAIN	Not recorded	MG MAGNESIUM ION × 1 ACT ACETATE ION × 3 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；5 MG/ML PROTEIN, 50 MM NA ACETATE PH 4.6, 75 MM KCL, 3.5% PEG 4K, 2.5 MM ATP, 10 MM MGCL2	Resolution 1.80 Å R-free 0.288
1MKJ Human Kinesin Motor Domain With Docked Neck Linker Deposited 2002-08-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa） Fragment：Residues 1-349	Not recorded	MG MAGNESIUM ION × 1 SO4 SULFATE ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；277 K；1.5-2 M Li2SO4, 25 mM HEPES pH 7.5, 0-50 mM KCl, pH 7.50, temperature 277K	Resolution 2.70 Å R-free 0.255
3J8X High-resolution structure of no-nucleotide kinesin on microtubules Deposited 2014-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 1–349（349 aa） Fragment：Truncated catalytic head domain (monomeric, UNP residues 1-349)	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 25 mM PIPES, 25 mM NaCl, 2 mM MgCl2, 1 mM EGTA；pH 6.8；25 mM PIPES, 25 mM NaCl, 2 mM MgCl2, 1 mM EGTA cryo-EM vitrification conditions No glow discharge was applied. After sample application to grid, liquid was mostly 'wicked' away by edgewise application of filter paper. Subsequently, blotting and plunge freezing were performed with ~0.5 second delay after blotting but prior to plunging.；Cryogen ETHANE；No glow discharge was applied. After sample application to grid, liquid was mostly 'wicked' away by edgewise application of filter paper. Subsequently, blotting and plunge freezing were performed with ~0.5 second delay after blotting but prior to plunging into liquid ethane.	Resolution 5.00 Å
3J8Y High-resolution structure of ATP analog-bound kinesin on microtubules Deposited 2014-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 1–349（349 aa） Fragment：Truncated catalytic head domain (monomeric, UNP residues 1-349)	Not recorded	ATP ADENOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer 25 mM PIPES, 25 mM NaCl, 2 mM MgCl2, 1 mM EGTA；pH 6.8；25 mM PIPES, 25 mM NaCl, 2 mM MgCl2, 1 mM EGTA cryo-EM vitrification conditions No glow discharge was applied. After sample application to grid, liquid was mostly 'wicked' away by edgewise application of filter paper. Subsequently, blotting and plunge freezing were performed with ~0.5 second delay after blotting but prior to plunging.；Cryogen ETHANE；No glow discharge was applied. After sample application to grid, liquid was mostly 'wicked' away by edgewise application of filter paper. Subsequently, blotting and plunge freezing were performed with ~0.5 second delay after blotting but prior to plunging into liquid ethane.	Resolution 5.00 Å
4HNA Kinesin motor domain in the ADP-MG-ALFX state in complex with tubulin and a DARPIN Deposited 2012-10-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain K 1–349（349 aa） Fragment：RESIDUES 1-349	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 3 GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.8；293 K；PEG, PIPES BUFFER, PH 6.8, 0.8 MM ALCL3, 4 MM NAF, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.19 Å R-free 0.211
4LNU Nucleotide-free kinesin motor domain in complex with tubulin and a DARPin Deposited 2013-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain K 1–325（325 aa） Fragment：UNP RESIDUES 1-325	Mutation：C7S, C65A, C168A, C174S, C294A	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 11 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；PEG, MES BUFFER, 0.2M AMMONIUM SULFATE, pH 6.50, VAPOR DIFFUSION, temperature 293K	Resolution 2.19 Å R-free 0.195
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT3 nucleotide-free kinesin-1 motor domain T87A mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain K 1–325（325 aa）	Mutation：C7S, C65A, T87A, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.2M ammonium sulfate 30% mPEG 5000	Resolution 2.59 Å R-free 0.263
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
5LT4 nucleotide-free kinesin-1 motor domain T92V mutant, P1 crystal form Deposited 2016-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain K 1–325（325 aa）	Mutation：C7S, C65A, T92V, C168A, C174S, C294A	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM Mes pH 6.5 0.16 M ammonium sulfate 30% mPEG 5000	Resolution 2.88 Å R-free 0.280
6OJQ Monomeric kinesin-1 motor domain in no-nucleotide state bound to GMPCPP-stabilized microtubule Deposited 2019-04-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 8–324（317 aa）	Not recorded	G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 1 MG MAGNESIUM ION × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.67 Å
7RIK Magic-Angle-Spinning NMR Structure of Kinesin-1 Motor Domain Assembled with Microtubules Deposited 2021-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa） Fragment：Kinesin motor domain residues 1-349	Not recorded	No recorded non-water small molecule	SOLID-STATE NMR NMR measurement conditions pH 7.4；283 K；Ionic strength (raw mmCIF value) 100；Pressure 1 NMR sample composition 9.1 % w/w [U-100% 13C; U-100% 15N] Apo-Kif5b, 16.4 % w/w Porcine-alpha-tubulin, 16.4 % w/w Porcine-beta-tubulin, 5 uM TAXOL, 1 mM GUANOSINE-5'-TRIPHOSPHATE, 1 mM GUANOSINE-5'-DIPHOSPHATE, 58.1 % w/w Buffer, 100% H2O \| 100% H2O NMR sample composition 9.1 % w/w [U-100% 13C; U-100% 15N] Apo-Kif5b, 16.4 % w/w Porcine-alpha-tubulin, 16.4 % w/w Porcine-beta-tubulin, 5 uM TAXOL, 1 mM GUANOSINE-5'-TRIPHOSPHATE, 1 mM GUANOSINE-5'-DIPHOSPHATE, 58.1 % w/w Buffer, 100% H2O \| 100% H2O NMR sample composition 8.2 % w/w [1,6-13C-glucose; U-100% 15N] Apo-Kif5b, 16.4 % w/w Porcine-alpha-tubulin, 16.4 % w/w Porcine-beta-tubulin, 5 uM TAXOL, 1 mM GUANOSINE-5'-TRIPHOSPHATE, 1 mM GUANOSINE-5'-DIPHOSPHATE, 59 % w/w Buffer, 100% H2O \| 100% H2O NMR sample composition 7.6 % w/w [2-13C-glucose; U-100% 15N] Apo-Kif5b, 16.4 % w/w Porcine-alpha-tubulin, 16.4 % w/w Porcine-beta-tubulin, 5 uM TAXOL, 1 mM GUANOSINE-5'-TRIPHOSPHATE, 1 mM GUANOSINE-5'-DIPHOSPHATE, 59.6 % w/w Buffer, 100% H2O \| 100% H2O	Resolution not provided
7TR1 CaKip3[2-436]-L2-mutant(HsKHC) - AMP-PNP in complex with a microtubule Deposited 2022-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 41–44（4 aa）	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7TR2 Apo CaKip3[2-436]-L2-mutant(HsKHC) in complex with a microtubule Deposited 2022-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 41–44（4 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8IXB GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain g 1–349（349 aa） Chain k 1–349（349 aa） Chain l 1–349（349 aa） Chain m 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
8IXD GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin non-seam region Deposited 2023-03-31	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain S 1–349（349 aa） Chain T 1–349（349 aa） Chain U 1–349（349 aa） Chain V 1–349（349 aa） Chain W 1–349（349 aa） Chain X 1–349（349 aa） Chain Y 1–349（349 aa） Chain Z 1–349（349 aa） Chain a 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8IXE GMPCPP-Alpha1C/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain h 1–349（349 aa） Chain l 1–349（349 aa） Chain p 1–349（349 aa） Chain q 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8IXF GMPCPP-Alpha4A/Beta2A-microtubule decorated with kinesin non-seam region Deposited 2023-03-31	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain S 1–349（349 aa） Chain T 1–349（349 aa） Chain U 1–349（349 aa） Chain V 1–349（349 aa） Chain W 1–349（349 aa） Chain X 1–349（349 aa） Chain Y 1–349（349 aa） Chain Z 1–349（349 aa） Chain a 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 9 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 9 ATP ADENOSINE-5'-TRIPHOSPHATE × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8IXG GMPCPP-Alpha4A/Beta2A-microtubule decorated with kinesin seam region Deposited 2023-03-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain h 1–349（349 aa） Chain l 1–349（349 aa） Chain p 1–349（349 aa） Chain q 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 G2P PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å
8RHB Microtubule-associated kinesin-1 tail complex bound to AMPPNP, single-headed state Deposited 2023-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 1–963（963 aa） Chain T 1–963（963 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8；BRB80 + 5mM AMPPNP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8RHH Microtubule-associated kinesin-1 tail complex bound to AMPPNP, two-headed state Deposited 2023-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: pentameric	Chain K 1–963（963 aa） Chain L 1–963（963 aa） Chain T 1–963（963 aa） Chain t 1–963（963 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 2 MG MAGNESIUM ION × 3 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8；BRB80 + 5mM AMPPNP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8RIK Microtubule-associated kinesin-1 tail complex bound to ADP, single-headed state Deposited 2023-12-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: tetrameric	Chain K 1–963（963 aa） Chain T 1–963（963 aa） Chain t 1–963（963 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8；BRB80 + 5 mM ADP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8RIZ Microtubule-associated kinesin-1 tail complex bound to ADP, two-headed state Deposited 2023-12-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 1–963（963 aa） Chain L 1–963（963 aa） Chain T 1–963（963 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8；BRB80 + 5mM ADP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
9GNQ Microtubule-associated Kif5B IAK tail mutant bound to ADP Deposited 2024-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 1–357（357 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 TA1 TAXOL × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8；BRB80 + 5mM AMPPNP cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
9L6K Crystal structure of nucleotide-free human kinesin-1 motor domain (G234V mutant) Deposited 2024-12-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–336（335 aa）	Mutation：G234V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；277 K；20% PEG 3350, 100mM HEPES-NaOH, 200mM ammonium acetate, 3% xylitol	Resolution 2.80 Å R-free 0.258
9L6K Crystal structure of nucleotide-free human kinesin-1 motor domain (G234V mutant) Deposited 2024-12-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–336（335 aa）	Mutation：G234V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.8；277 K；20% PEG 3350, 100mM HEPES-NaOH, 200mM ammonium acetate, 3% xylitol	Resolution 2.80 Å R-free 0.258
9L78 Crystal structure of nucleotide-free human kinesin-1 motor domain (G234A mutant) Deposited 2024-12-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–336（335 aa）	Mutation：G234A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；20 % PEG 3350, 100mM HEPES-NaOH, 200mM ammonium acetate, 3% xylitol, pH 7.9	Resolution 2.82 Å R-free 0.265
9L78 Crystal structure of nucleotide-free human kinesin-1 motor domain (G234A mutant) Deposited 2024-12-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–336（335 aa）	Mutation：G234A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；20 % PEG 3350, 100mM HEPES-NaOH, 200mM ammonium acetate, 3% xylitol, pH 7.9	Resolution 2.82 Å R-free 0.265
9L7E Crystal structure of human kinesin-1 motor domain (G234A mutant) in complex with ADP Deposited 2024-12-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–349（349 aa）	Mutation：G234A	MG MAGNESIUM ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；23% PEG 3350, 100mM Bis-Tris, pH 5.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.252
9L7M Nucleotide-free kinesin-1 motor domain bound to the microtubule Deposited 2024-12-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain K 1–349（349 aa）	Not recorded	GTP GUANOSINE-5'-TRIPHOSPHATE × 4 MG MAGNESIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 6.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.48 Å

26 other PDB entries and 38 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KINH_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain S； PDBConstruct 24–372； UniProt 1–349 Author chain T； PDBConstruct 24–372； UniProt 1–349 Author chain U； PDBConstruct 24–372； UniProt 1–349 Author chain V； PDBConstruct 24–372； UniProt 1–349 Author chain W； PDBConstruct 24–372； UniProt 1–349 Author chain X； PDBConstruct 24–372； UniProt 1–349 Author chain Y； PDBConstruct 24–372； UniProt 1–349 Author chain Z； PDBConstruct 24–372； UniProt 1–349 Author chain a； PDBConstruct 24–372； UniProt 1–349

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ixa
Deposition date deposition_date	2023-03-31
Structure title title	GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin non-seam region
Keywords keywords	microtubule, tubulin isotype, cryo-EM structure, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	87.84 Å
Radius of gyration Rg (electron density) rg_electron	88.13 Å
Forward intensity I(0) i0	21062700000.00
Molecular weight molecular_weight	1199300.0 kDa
Excluded volume excluded_volume	1484500 Å³
Envelope volume envelope_volume	2223800 Å³
Hydration-shell volume shell_volume	212100 Å³
Envelope diameter envelope_diameter	316.7 Å
Shell Rg shell_rg	80.55 Å
Envelope Rg envelope_rg	85.91 Å
Shape Rg shape_rg	88.13 Å
Total Rg total_rg	88.07 Å
Total atoms total_atoms	84087
Residues n_residues	10602
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	232.7 Å
Rg (real space) rg_real	84.31 Å
Rg uncertainty (real space) rg_real_error	0.68 Å
I(0) (real space) i0_real	2.0120e+10
I(0) uncertainty (real space) i0_real_error	3.6340e+08
Rg (reciprocal space) rg_reciprocal	86.51 Å
I(0) (reciprocal space) i0_reciprocal	20980000000.0000
Solution quality estimate total_estimate	0.9117
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	90.5 Å
Skewness Skewness skewness	0.259
Kurtosis Kurtosis kurtosis	-0.639
Angular range angular_range	— – 0.0900 Å⁻¹
Current regularization parameter α current_alpha	1.0270
Highest regularization parameter α highest_alpha	719800000.0000
Real-space data points n_real_points	19
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 1.000; Stabil: 0.966; Sysdev: 1.000; Positv: 1.000; Valcen: 0.955; Smooth: 0.002

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Tubulin alpha-1A chain
Molecular weight formula_weight	51017.3 kDa
EC 编号 ec_number	3.6.5.-
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,A,B,C,D,E,F,G,H
Atom count atom_count	84087

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIHHHHHHGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Insecta environmental sample

Entity 2 Entity 2 polymer

Description description	Tubulin beta-2A chain
Molecular weight formula_weight	51151.0 kDa
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,J,K,L,M,N,O,P,R

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEAGGSGGDYKDDDK

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Insecta environmental sample

Entity 3 Entity 3 polymer

Description description	Kinesin-1 heavy chain
Molecular weight formula_weight	41721.1 kDa
Source method src_method	man
Copy count entity_count	9

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,S,T,U,V,W,X,Z,a

MGSSHHHHHHSSGLVPRGSHMASMADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSAKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKE

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 5 Entity 5 non-polymer

Description description	PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER
Molecular weight formula_weight	521.2 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 6 Entity 6 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	9

▶

8. Citations (1)

▶

Resolution resolution	4.20 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	19287

fit	/app/data/saxs_computation/ix/8ixa/8ixa.fit
pddf	/app/data/pr_computation/ix/8ixa/8ixa.pr.out
profile	/app/data/saxs_computation/ix/8ixa/8ixa.dat

GMPCPP-Alpha1A/Beta2A-microtubule decorated with kinesin non-seam region

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Tubulin beta-2A chain

State in the Current Structure

Other States of the Same Protein in the Database

Kinesin-1 heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)