SAXSdb — 9l4j

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Isoform 4 of NACHT, LRR and PYD domains-containing protein 5

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Transducin-like enhancer protein 6 × 1 （Q9WVB3） Oocyte-expressed protein homolog × 1 （Q9CWE6） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NALP5_MOUSE
Isoform	Q9R1M5-4
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–963； UniProt 97–1059

Transducin-like enhancer protein 6

Mus musculus

UniProt Q9WVB3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Isoform 4 of NACHT, LRR and PYD domains-containing protein 5 × 1 （Q9R1M5） Oocyte-expressed protein homolog × 1 （Q9CWE6） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TLE6_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–427； UniProt 155–581

Oocyte-expressed protein homolog

Mus musculus

UniProt Q9CWE6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Isoform 4 of NACHT, LRR and PYD domains-containing protein 5 × 1 （Q9R1M5） Transducin-like enhancer protein 6 × 1 （Q9WVB3） Zinc finger BED domain-containing protein 3 × 1 （Q9D0L1） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OOEP_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–89； UniProt 26–114

Zinc finger BED domain-containing protein 3

Mus musculus

UniProt Q9D0L1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Isoform 4 of NACHT, LRR and PYD domains-containing protein 5 × 1 （Q9R1M5） Transducin-like enhancer protein 6 × 1 （Q9WVB3） Oocyte-expressed protein homolog × 1 （Q9CWE6） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ZBED3_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–56； UniProt 34–89

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9l4j
Deposition date deposition_date	2024-12-20
Structure title title	Structure of mouse SCMCcore complex contain ZBED3
Keywords keywords	complex, CYTOSOLIC PROTEIN; CYTOSOLIC PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9l4j__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9l4j__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9l4j__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	36.65 Å
Rg (electron density)	35.89 Å
Total Rg	36.49 Å
Atom count	11293
Residues	1430
Excluded volume	202620 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9l4j__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Isoform 4 of NACHT, LRR and PYD domains-containing protein 5
Molecular weight formula_weight	109296.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	11293

DLQDYKAHVIAKFDTSVDLHYDSPEMKLLSDAFKPYQKTFQPHTIILHGRPGVGKSALARSIVLGWAQGKLFQKMSFVIFFSVREIKWTEKSSLAQLIAKECPDSWDLVTKIMSQPERLLFVIDGLDDMDSVLQHDDMTLSRDWKDEQPIYILMYSLLRKALLPQSFLIITTRNTGLEKLKSMVVSPLYILVEGLSASRRSQLVLENISNESDRIQVFHSLIENHQLFDQCQAPSVCSLVCEALQLQKKLGKRCTLPCQTLTGLYATLVFHQLTLKRPSQSALSQEEQITLVGLCMMAAEGVWTMRSVFYDDDLKNYSLKESEILALFHMNILLQVGHNSEQCYVFSHLSLQDFFAALYYVLEGLEEWNQHFCFIENQRSIMEVKRTDDTRLLGMKRFLFGLMNKDILKTLEVLFEYPVIPTVEQKLQHWVSLIAQQVNGTSPMDTLDAFYCLFESQDEEFVGGALKRFQEVWLLINQKMDLKVSSYCLKHCQNLKAIRVDIRDLLSVDNTLELCPVVTVQETQCKPLLMEWWGNFCSVLGSLRNLKELDLGDSILSQRAMKILCLELRNQSCRIQKLTFKSAEVVSGLKHLWKLLFSNQNLKYLNLGNTPMKDDDMKLACEALKHPKCSVETLRLDSCELTIIGYEMISTLLISTTRLKCLSLAKNRVGVKSMISLGNALSSSMCLLQKLILDNCGLTPASCHLLVSALFSNQNLTHLCLSNNSLGTEGVQQLCQFLRNPECALQRLILNHCNIVDDAYGFLAMRLANNTKLTHLSLTMNPVGDGAMKLLCEALKEPTCYLQELELVDCQLTQNCCEDLACMITTTKHLKSLDLGNNALGDKGVITLCEGLKQSSSSLRRLGLGACKLTSNCCEALSLAISCNPHLNSLNLVKNDFSTSGMLKLCSAFQCPVSNLGIIGLWKQEYYARVRRQLEEVEFVKPHVVIDGDWYASDEDDRNWWKN

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Transducin-like enhancer protein 6
Molecular weight formula_weight	47967.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

PQFCQGFLIQGLWELFMDSRQKNQQEHGGEDSSQESKDSGLCDFKPEPQPRHRNSLSDSADPFLIKSPSALLDYYQEDVSRPQPETQESSGRADKFLKPLSWGSEVLESSCNQPSTALWQLERFTVPQALQKVRVLKHQELLLVVAVSSFTRHVFTCSQSGIKVWNLVNQVAEDRDPESHLKCSVQDNKVYLRTCLLSSNSRTLFAGGYNLPGVIVWDLAAPSLYEKCQLPCEGLSCQALANTKENMALAGFTDGTVRIWDLRTQEIVRNLKGPTNSARNLVVKDDNIWTGGLDACLRCWDLRMAKVSLEHLFQSQIMSLAHSPTEDWLLLGLANGQHCLFNSRKRDQVLTVDTKDNTILGLKFSPNGKWWASVGMGNFITVHSMPTGAKLFQVPEVGPVRCFDMTENGRLIITGSRDCASVYHIKY

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Spodoptera frugiperda

Entity 3 Entity 3 polymer

Description description	Oocyte-expressed protein homolog
Molecular weight formula_weight	10252.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

SLRLRTRPWWFPIQEVSNPLVLYMEAWVAERVIGTDQAEISEIEWMCQALLTVDSVNSGNLAEITIFGQPSAQTRMKNILLNMAAWHKE

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Spodoptera frugiperda granulovirus

Entity 4 Entity 4 polymer

Description description	Zinc finger BED domain-containing protein 3
Molecular weight formula_weight	6483.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

SYSEAWGYFHLDPAQPRHRMMSAWATCRLCGLQVGGLPNFQMWTRALCQHLSDVHL

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Spodoptera frugiperda

Entity 5 Entity 5 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	1993029

Structure of mouse SCMCcore complex contain ZBED3

1. Protein Identity and Related Structures Protein Identity & Related Structures

Isoform 4 of NACHT, LRR and PYD domains-containing protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Transducin-like enhancer protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Oocyte-expressed protein homolog

State in the Current Structure

Other States of the Same Protein in the Database

Zinc finger BED domain-containing protein 3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9l4j__assembly_1__model_1

9l4j__assembly_1__model_1 | I(q)

9l4j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)

Structure of mouse SCMCcore complex contain ZBED3

1. Protein Identity and Related Structures Protein Identity & Related Structures

Isoform 4 of NACHT, LRR and PYD domains-containing protein 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transducin-like enhancer protein 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Oocyte-expressed protein homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Zinc finger BED domain-containing protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9l4j__assembly_1__model_1

9l4j__assembly_1__model_1 | I(q)

9l4j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)