SAXSdb — 8k42

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	VP8 × 65 （W0G587） VP10 × 10 （A0A2H4QDD3） VP4 × 30 （B4Y048） VP9 × 30 （Q9YWN5）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 29	VP8 × 13 （W0G587） VP10 × 2 （A0A2H4QDD3） VP4 × 6 （B4Y048） VP9 × 6 （Q9YWN5）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 29	VP8 × 13 （W0G587） VP10 × 2 （A0A2H4QDD3） VP4 × 6 （B4Y048） VP9 × 6 （Q9YWN5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9INH3_9REOV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–955； UniProt 1–955 Author chain B； PDBConstruct 1–955； UniProt 1–955

VP8

OrganismNot specified

UniProt W0G587

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	VP2 × 10 （Q9INH3） VP10 × 10 （A0A2H4QDD3） VP4 × 30 （B4Y048） VP9 × 30 （Q9YWN5）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 29	VP2 × 2 （Q9INH3） VP10 × 2 （A0A2H4QDD3） VP4 × 6 （B4Y048） VP9 × 6 （Q9YWN5）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 29	VP2 × 2 （Q9INH3） VP10 × 2 （A0A2H4QDD3） VP4 × 6 （B4Y048） VP9 × 6 （Q9YWN5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W0G587_9REOV
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–302； UniProt 1–302 Author chain D； PDBConstruct 1–302； UniProt 1–302 Author chain E； PDBConstruct 1–302； UniProt 1–302 Author chain F； PDBConstruct 1–302； UniProt 1–302 Author chain G； PDBConstruct 1–302； UniProt 1–302 Author chain H； PDBConstruct 1–302； UniProt 1–302 Author chain I； PDBConstruct 1–302； UniProt 1–302 Author chain J； PDBConstruct 1–302； UniProt 1–302 Author chain K； PDBConstruct 1–302； UniProt 1–302 Author chain L； PDBConstruct 1–302； UniProt 1–302 Author chain M； PDBConstruct 1–302； UniProt 1–302 Author chain N； PDBConstruct 1–302； UniProt 1–302 Author chain O； PDBConstruct 1–302； UniProt 1–302

VP10

OrganismNot specified

UniProt A0A2H4QDD3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	VP2 × 10 （Q9INH3） VP8 × 65 （W0G587） VP4 × 30 （B4Y048） VP9 × 30 （Q9YWN5）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 29	VP2 × 2 （Q9INH3） VP8 × 13 （W0G587） VP4 × 6 （B4Y048） VP9 × 6 （Q9YWN5）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 29	VP2 × 2 （Q9INH3） VP8 × 13 （W0G587） VP4 × 6 （B4Y048） VP9 × 6 （Q9YWN5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2H4QDD3_9REOV
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain P； PDBConstruct 1–249； UniProt 1–249 Author chain Q； PDBConstruct 1–249； UniProt 1–249

VP4

OrganismNot specified

UniProt B4Y048

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	VP2 × 10 （Q9INH3） VP8 × 65 （W0G587） VP10 × 10 （A0A2H4QDD3） VP9 × 30 （Q9YWN5）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 29	VP2 × 2 （Q9INH3） VP8 × 13 （W0G587） VP10 × 2 （A0A2H4QDD3） VP9 × 6 （Q9YWN5）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 29	VP2 × 2 （Q9INH3） VP8 × 13 （W0G587） VP10 × 2 （A0A2H4QDD3） VP9 × 6 （Q9YWN5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B4Y048_9REOV
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain R； PDBConstruct 1–628； UniProt 1–628 Author chain S； PDBConstruct 1–628； UniProt 1–628 Author chain T； PDBConstruct 1–628； UniProt 1–628 Author chain U； PDBConstruct 1–628； UniProt 1–628 Author chain V； PDBConstruct 1–628； UniProt 1–628 Author chain W； PDBConstruct 1–628； UniProt 1–628

VP9

OrganismNot specified

UniProt Q9YWN5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 145	VP2 × 10 （Q9INH3） VP8 × 65 （W0G587） VP10 × 10 （A0A2H4QDD3） VP4 × 30 （B4Y048）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 29	VP2 × 2 （Q9INH3） VP8 × 13 （W0G587） VP10 × 2 （A0A2H4QDD3） VP4 × 6 （B4Y048）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 29	VP2 × 2 （Q9INH3） VP8 × 13 （W0G587） VP10 × 2 （A0A2H4QDD3） VP4 × 6 （B4Y048）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9YWN5_9REOV
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain r； PDBConstruct 1–283； UniProt 1–283 Author chain s； PDBConstruct 1–283； UniProt 1–283 Author chain t； PDBConstruct 1–283； UniProt 1–283 Author chain u； PDBConstruct 1–283； UniProt 1–283 Author chain v； PDBConstruct 1–283； UniProt 1–283 Author chain w； PDBConstruct 1–283； UniProt 1–283

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8k42
Deposition date deposition_date	2023-07-17
Structure title title	Structure of full Banna virus
Keywords keywords	reovirus, complex, capsid protein, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8k42__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8k42__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8k42__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	132.10 Å
Total Rg	132.10 Å
Atom count	381795
Residues	48985
Excluded volume	6789300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8k42__assembly_1__model_1`	145-meric （145）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8k42__assembly_2__model_1`	29-meric （29）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`8k42__assembly_3__model_1`	29-meric （29）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	VP2
Molecular weight formula_weight	108031.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	76359

MPRKKDQVTKNDDGNQTSDVQTQDFKTAVQPDTNTAQLIKTYSNPKQRGDKGEIIYDGGLSSKLADVVDKTTEPHNADGAVKDGRIAPVKLDLEKQKLDKLKLFETSPFDPLTIKNNQDVVDKLYATQSSSIQEVVPTKTFATELQFGVTSEDMAKIYGAVAAVSKNVNSSVTYEVKRGTHELIKVPTIPHNLVLIQSDNGKHALIKEDLGQWPVETGISLVNQAGVFAVQLANKLGIDKPFVLDAGSNYFTDTSFIDTRKYCTDGLSPREIQKALNRQRAYYDRPELTISENKTLLSQSIIYPDADGNDVSIIFSGAMSHAIFTYAQSQWNKNIIKLDDYIREITLTVPKQYRPRRFKEIEHTHGYVYRELNQGSLLPLVDANLKESSSYYFKKLMSSISNVPVDARTLQSATAALAADTGQAVNRAQHVSMLTNRLTTANAPTVRAITVLTCMFKQFRIGMTYALDPNIMDVAAATCMLLFRPAQSISDEQYRYCLQTMAVFLTNTTYDIVNNDTIDVLKMKLRNQGWPFVERYNAVEIDMSVEPLRSPGQVGRYYNPFNIDPLTKKHVEDRLEEFINQVQVGRFRNASGNAVGTTLAAFLRACRDKTSANWRGYSVLVSRYRSLIPNELFESLRNISGEYNINPQDEHSFFFALAQINADDEFIGAIDKESAEYLDEYATLARDISNSLTLVKAAFGPLERTSGSIINHANNLNKVINHVFADKPLISETMLKILTIDGTTGKDGYRNWLDKLVGHNYPVYVEPVVNIMNFISARFVADSSYFGYTNEIMIMPNHINVPVDDRFGFRDSPFCTSLPRTIMGNDVRRISYNVFSMMEDIDDVISEGFILYDAYFNFSYDIMTTDGVTRLKEDILIVTDTGNDIKPIHFYIYFENRNDKKLRYESKMNVSYRLYIKTPACLLPLSDYMRAQHDYVSPSSSRVYIKDPAVVYTRS

Entity 2 Entity 2 polymer

Description description	VP8
Molecular weight formula_weight	32885.3 kDa
Source method src_method	nat
Copy count entity_count	13

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,E,F,G,H,I,J,K,L,M,N,O

MANRATSAFLDNPHPVGVNYVDEGSRQFVAVAELLASKLIDSSRESDESNSDVPFVQAYSKFADDNPRHLRVKTGGKMANALTNVIRSYYSINAPAIVPQVEIDRLASKATVSGDMYNSYAIFNSVPIVEVLSPARTTVSIVGSDRADVTMLNTGAGAANITFNFGQIAETVILKGSVPFQLARLNQPMPAARFTYKLRPLDGPFIVVLPVGNPLVISATAATRIQVPLAFNKALVESGFQTAMNDGLFDIQNVNYYSSFDEFIISQYHAQDGINRVSTCVILGLALQAYDQMRRALPVRRV

Entity 3 Entity 3 polymer

Description description	VP10
Molecular weight formula_weight	28655.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Q

MDVLSKGSLKELLAHLEKTPLEEAISYRIGTVPYQNVLISRNEYYNQLYPDTTSLIDGVSREGQRNVNGLIMSIISYVVSGSGHYIPNIGFMLLRRSILDILTKHDTGLVTNNLNYGIIARNLTVSKMNCEQRKRMLICFKLLAYKDGNQNDYEIYLNQNIPLKQIAPNFIPGDMRTVIHNQDQLAIVGIPAYRLTQSTELSIRDDNAKSYKLGYVDWYNSNSFLRERSEFNLIRLKDRDTKYGKLNGW

Entity 4 Entity 4 polymer

Description description	VP4
Molecular weight formula_weight	69767.5 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,S,T,U,V,W

MAWVTQAYSSGLSQNSIISLTGNDRTVADGTFNSMIMPRAVIANEREHFMKTRIDKIEHDLNRSAKQEMMDRQSLAEDYNALNLAVGQEIKLDIATQHQLNRLGSAMYKADHERETELTDLINRIRENEVTVNGILENQKAITAAERADLLLEVVASTAKSVSAAGRAAADGSGVVPVFGPSVANGIKVGIDIADSVAEAAIAVKESGIITQLNDVYHAFQSVHVAPNDVIKPAAVVAGTSTELIGNLQAIYSRLRSHSDIGFKKATVGDVIPNSYMIKPVNSTEYASWQLYVIHPVQGSLGLVVQLMGDALTYNVFAQYGNTSASEFGKTVLTGGATNTALEGTKVKFQTKVTAQQALALTMALKDAASMLSQGELIGYFEQYINLALEPDNLSLQDNMHKYHHLLTSQNSPIDWNYHDEEMHKWLDSRKTTNYDAMQKKDGTVIADIHIPKVFNDLRNTTLHCKLEGKQTIAGYTVYEYLIGPWAHYGDIDYSVVVDTLNEETKWYCEVIGIDGHLLIEKSVQHKPEKILELTVNDSGVTSFNGRNHDRLKLKVYVKDSLSVKVFRNWIGINAPRVKTKMFNDHIGVKYDYSHFDKNISPAHLTLTDLGWHTWDQYNAGNWTNIKP

Entity 5 Entity 5 polymer

Description description	VP9
Molecular weight formula_weight	30581.2 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r,s,t,u,v,w

MLSETELRALKKLSTTTSRVVGDSTLALPSNVKLSKGEVEKIAVTKKEMFDELAQCNLPTIELITREHTFNGDVIRFAAWLFLMNGQKLMIANNVAVRMGMQYATNLAGNNVKITYVTSNNVVKLGHIAAGVLANPYSNKGSGLFITYEYNLISNLIETGKVCVLFITSLSTTASSTNSFAYSTCSVPIENWDFNMIKLTAETSCASLTAMTNLVNSLVPGERTRPVGLYVDIPGVTVTTSASSGSLPLTTIPAVTPLIFSAYTKQVEEVGVINTLYALSYLP

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.64 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	293354

Structure of full Banna virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP2

State in the Current Structure

Other States of the Same Protein in the Database

VP8

State in the Current Structure

Other States of the Same Protein in the Database

VP10

State in the Current Structure

Other States of the Same Protein in the Database

VP4

State in the Current Structure

Other States of the Same Protein in the Database

VP9

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8k42__assembly_1__model_1

8k42__assembly_1__model_1 | I(q)

8k42__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)

Structure of full Banna virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

VP8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

VP10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

VP4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

VP9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8k42__assembly_1__model_1

8k42__assembly_1__model_1 | I(q)

8k42__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

7. Citations (1)