8ki3

Structure of the human ATP synthase bound to bedaquiline (composite)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPA_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–510； UniProt 44–553 Author chain B； PDBConstruct 1–510； UniProt 44–553 Author chain C； PDBConstruct 1–510； UniProt 44–553

ATP synthase subunit beta, mitochondrial

OrganismNot specified

UniProt P06576

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPB_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–482； UniProt 48–529 Author chain E； PDBConstruct 1–482； UniProt 48–529 Author chain F； PDBConstruct 1–482； UniProt 48–529

ATP synthase subunit gamma, mitochondrial

OrganismNot specified

UniProt P36542

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPG_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–273； UniProt 26–298

ATPase inhibitor, mitochondrial

OrganismNot specified

UniProt Q9UII2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATIF1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain J； PDBConstruct 1–81； UniProt 26–106

ATP synthase subunit O, mitochondrial

OrganismNot specified

UniProt P48047

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPO_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain O； PDBConstruct 1–190； UniProt 24–213

ATP synthase F(0) complex subunit C1, mitochondrial

OrganismNot specified

UniProt P05496

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AT5G1_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 1； PDBConstruct 1–75； UniProt 62–136 Author chain 2； PDBConstruct 1–75； UniProt 62–136 Author chain 3； PDBConstruct 1–75； UniProt 62–136 Author chain 4； PDBConstruct 1–75； UniProt 62–136 Author chain 5； PDBConstruct 1–75； UniProt 62–136 Author chain 6； PDBConstruct 1–75； UniProt 62–136 Author chain 7； PDBConstruct 1–75； UniProt 62–136 Author chain 8； PDBConstruct 1–75； UniProt 62–136

ATP synthase subunit delta, mitochondrial

OrganismNot specified

UniProt P30049

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPD_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–146； UniProt 23–168

ATP synthase subunit epsilon, mitochondrial

OrganismNot specified

UniProt P56381

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5E_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–51； UniProt 1–51

ATP synthase F(0) complex subunit B1, mitochondrial

OrganismNot specified

UniProt P24539

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AT5F1_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–214； UniProt 43–256

ATP synthase subunit d, mitochondrial

OrganismNot specified

UniProt O75947

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5H_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain M； PDBConstruct 1–160； UniProt 2–161

ATP synthase subunit a

OrganismNot specified

UniProt P00846

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP6_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain N； PDBConstruct 1–226； UniProt 1–226

ATP synthase subunit ATP5MJ, mitochondrial

OrganismNot specified

UniProt P56378

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP68_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain P； PDBConstruct 1–58； UniProt 1–58

ATP synthase protein 8

OrganismNot specified

UniProt P03928

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP8_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Q； PDBConstruct 1–68； UniProt 1–68

ATP synthase subunit f, mitochondrial

OrganismNot specified

UniProt P56134

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPK_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain R； PDBConstruct 1–93； UniProt 2–94

ATP synthase subunit g, mitochondrial

OrganismNot specified

UniProt O75964

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit e, mitochondrial × 1 （P56385） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5L_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain S； PDBConstruct 1–102； UniProt 2–103

ATP synthase subunit e, mitochondrial

OrganismNot specified

UniProt P56385

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase-coupling factor 6, mitochondrial × 1 （P18859） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5I_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain T； PDBConstruct 1–69； UniProt 1–69

ATP synthase-coupling factor 6, mitochondrial

OrganismNot specified

UniProt P18859

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ATP synthase subunit alpha, mitochondrial × 3 （P25705） ATP synthase subunit beta, mitochondrial × 3 （P06576） ATP synthase subunit gamma, mitochondrial × 1 （P36542） ATPase inhibitor, mitochondrial × 1 （Q9UII2） ATP synthase subunit O, mitochondrial × 1 （P48047） ATP synthase F(0) complex subunit C1, mitochondrial × 8 （P05496） ATP synthase subunit delta, mitochondrial × 1 （P30049） ATP synthase subunit epsilon, mitochondrial × 1 （P56381） ATP synthase F(0) complex subunit B1, mitochondrial × 1 （P24539） ATP synthase subunit d, mitochondrial × 1 （O75947） ATP synthase subunit a × 1 （P00846） ATP synthase subunit ATP5MJ, mitochondrial × 1 （P56378） ATP synthase protein 8 × 1 （P03928） ATP synthase subunit f, mitochondrial × 1 （P56134） ATP synthase subunit g, mitochondrial × 1 （O75964） ATP synthase subunit e, mitochondrial × 1 （P56385） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 Bedaquiline × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATP5J_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain L； PDBConstruct 1–108； UniProt 1–108

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ki3
Deposition date deposition_date	2023-08-22
Structure title title	Structure of the human ATP synthase bound to bedaquiline (composite)
Keywords keywords	ATP synthase, Human, cryo-EM, Membrane protein; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ki3__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ki3__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ki3__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.72 Å
Rg (electron density)	66.36 Å
Total Rg	66.33 Å
Atom count	38654
Residues	5047
Excluded volume	696050 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ki3__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit alpha, mitochondrial
Molecular weight formula_weight	55276.2 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	38662

QKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFEA

Entity 2 Entity 2 polymer

Description description	ATP synthase subunit beta, mitochondrial
Molecular weight formula_weight	51822.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

AQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS

Entity 3 Entity 3 polymer

Description description	ATP synthase subunit gamma, mitochondrial
Molecular weight formula_weight	30207.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

ATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD

Entity 4 Entity 4 polymer

Description description	ATPase inhibitor, mitochondrial
Molecular weight formula_weight	9540.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

GSDQSENVDRGAGSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIERLQKEIERHKQKIKMLKHDD

Entity 5 Entity 5 polymer

Description description	ATP synthase subunit O, mitochondrial
Molecular weight formula_weight	20904.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV

Entity 6 Entity 6 polymer

Description description	ATP synthase F(0) complex subunit C1, mitochondrial
Molecular weight formula_weight	7611.0 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,3,4,5,6,7,8

DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM

Entity 7 Entity 7 polymer

Description description	ATP synthase subunit delta, mitochondrial
Molecular weight formula_weight	15029.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Entity 8 Entity 8 polymer

Description description	ATP synthase subunit epsilon, mitochondrial
Molecular weight formula_weight	5790.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE

Entity 9 Entity 9 polymer

Description description	ATP synthase F(0) complex subunit B1, mitochondrial
Molecular weight formula_weight	24658.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

PVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM

Entity 10 Entity 10 polymer

Description description	ATP synthase subunit d, mitochondrial
Molecular weight formula_weight	18384.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

AGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

Entity 11 Entity 11 polymer

Description description	ATP synthase subunit a
Molecular weight formula_weight	24833.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT

Entity 12 Entity 12 polymer

Description description	ATP synthase subunit ATP5MJ, mitochondrial
Molecular weight formula_weight	6673.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH

Entity 13 Entity 13 polymer

Description description	ATP synthase protein 8
Molecular weight formula_weight	8000.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS

Entity 14 Entity 14 polymer

Description description	ATP synthase subunit f, mitochondrial
Molecular weight formula_weight	10804.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

ASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Entity 15 Entity 15 polymer

Description description	ATP synthase subunit g, mitochondrial
Molecular weight formula_weight	11309.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

AQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV

Entity 16 Entity 16 polymer

Description description	ATP synthase subunit e, mitochondrial
Molecular weight formula_weight	7947.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK

Entity 17 Entity 17 polymer

Description description	ATP synthase-coupling factor 6, mitochondrial
Molecular weight formula_weight	12606.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA

Entity 18 Entity 18 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 19 Entity 19 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 20 Entity 20 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	Bedaquiline
Molecular weight formula_weight	555.5 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.89 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	84037

Structure of the human ATP synthase bound to bedaquiline (composite)

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit beta, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit gamma, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATPase inhibitor, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit O, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase F(0) complex subunit C1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit delta, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit epsilon, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase F(0) complex subunit B1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit d, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer