8ovw

Cryo-EM structure of CBF1-CCAN bound topologically to centromeric DNA

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Centromere-binding protein 1

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CBF1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–351； UniProt 1–351 Author chain B； PDBConstruct 1–351； UniProt 1–351

Inner kinetochore subunit MCM16

Saccharomyces cerevisiae

UniProt Q12262

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPH_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain H； PDBConstruct 1–181； UniProt 1–181

Inner kinetochore subunit CTF3

Saccharomyces cerevisiae

UniProt Q12748

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPI_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–733； UniProt 1–733

Inner kinetochore subunit MCM22

Saccharomyces cerevisiae

UniProt P47167

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPK_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain K； PDBConstruct 1–239； UniProt 1–239

Inner kinetochore subunit IML3

Saccharomyces cerevisiae

UniProt P38265

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPL_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain L； PDBConstruct 1–245； UniProt 1–245

Inner kinetochore subunit CHL4

Saccharomyces cerevisiae

UniProt P38907

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPN_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain N； PDBConstruct 1–458； UniProt 1–458

Inner kinetochore subunit MCM21

Saccharomyces cerevisiae

UniProt Q06675

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPO_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain O； PDBConstruct 1–368； UniProt 1–368

Inner kinetochore subunit CTF19

Saccharomyces cerevisiae

UniProt Q02732

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPP_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain P； PDBConstruct 1–369； UniProt 1–369

Inner kinetochore subunit OKP1

Saccharomyces cerevisiae

UniProt P53298

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPQ_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Q； PDBConstruct 1–406； UniProt 1–406

Inner kinetochore subunit CNN1

Saccharomyces cerevisiae

UniProt P43618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPT_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain T； PDBConstruct 1–361； UniProt 1–361

Inner kinetochore subunit AME1

Saccharomyces cerevisiae

UniProt P38313

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPU_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain U； PDBConstruct 1–324； UniProt 1–324

Inner kinetochore subunit WIP1

Saccharomyces cerevisiae

UniProt Q2V2P8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit NKP1 × 1 （Q12493） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CENPW_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain W； PDBConstruct 1–89； UniProt 1–89

Inner kinetochore subunit NKP1

Saccharomyces cerevisiae

UniProt Q12493

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP2 × 1 （Q06162） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NKP1_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain Y； PDBConstruct 1–238； UniProt 1–238

Inner kinetochore subunit NKP2

Saccharomyces cerevisiae

UniProt Q06162

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 15 DNA 2	Centromere-binding protein 1 × 2 （P17106） C0N3 DNA × 1 Inner kinetochore subunit MCM16 × 1 （Q12262） Inner kinetochore subunit CTF3 × 1 （Q12748） Inner kinetochore subunit MCM22 × 1 （P47167） Inner kinetochore subunit IML3 × 1 （P38265） Inner kinetochore subunit CHL4 × 1 （P38907） Inner kinetochore subunit MCM21 × 1 （Q06675） Inner kinetochore subunit CTF19 × 1 （Q02732） Inner kinetochore subunit OKP1 × 1 （P53298） Inner kinetochore subunit CNN1 × 1 （P43618） Inner kinetochore subunit AME1 × 1 （P38313） Inner kinetochore subunit WIP1 × 1 （Q2V2P8） Inner kinetochore subunit NKP1 × 1 （Q12493） C0N3 DNA × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NKP2_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain Z； PDBConstruct 1–153； UniProt 1–153

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ovw
Deposition date deposition_date	2023-04-26
Structure title title	Cryo-EM structure of CBF1-CCAN bound topologically to centromeric DNA
Keywords keywords	kinetochore, point centromere, CENP-A nucleosome, topological entrapment, centromeric DNA, CELL CYCLE; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ovw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ovw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ovw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.21 Å
Rg (electron density)	56.40 Å
Total Rg	56.38 Å
Atom count	28461
Residues	3438
Excluded volume	507010 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ovw__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Centromere-binding protein 1
Molecular weight formula_weight	39444.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	28461

MNSLANNNKLSTEDEEIHSARKRGYNEEQNYSEARKKQRDQGLLSQESNDGNIDSALLSEGATLKGTQSQYESGLTSNKDEKGSDDEDASVAEAAVAATVNYTDLIQGQEDSSDAHTSNQTNANGEHKDSLNGERAITPSNEGVKPNTSLEGMTSSPMESTQQSKNDMLIPLAEHDRGPEHQQDDEDNDDADIDLKKDISMQPGRRGRKPTTLATTDEWKKQRKDSHKEVERRRRENINTAINVLSDLLPVRESSKAAILACAAEYIQKLKETDEANIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEIEYMKRVLRKEGIEYEDMHTHKKQENERKSTRSDNPHEA

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	C0N3 DNA
Molecular weight formula_weight	47194.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D

TTCAATGAAATATATATTTCTTACTATTTCTTTTTTAACTTTCGGAAATCAAATACACTAATATTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCATGTGACTTAT

Entity 3 Entity 3 polymer

Description description	Inner kinetochore subunit MCM16
Molecular weight formula_weight	21166.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MTNSSEKQWERIQQLEKEHVEVYRELLITLDRLYLIRKHNHAVILSHTQQRLLEIRHQLQINLEKTALLIRLLEKPDNTNVLFTKLQNLLEESNSLDYELLQSLGAQSSLHKQLIESRAERDELMSKLIELSSKFPKPTIPPDDSDTAGKQVEVEKENETIQELMIALQIHSGYTNISYTI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Inner kinetochore subunit CTF3
Molecular weight formula_weight	84345.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSLILDDIILSLTNANERTPPQALKTTLSLLYEKSKQYGLSSPQLQALVRLLCETSIIDTVTKVYIVENCFLPDGYLTKELLLEIINHLGTPTVFSRYRIQTPPVLQSALCKWLVHVYFLFPVHSEREHNISSSIWLHLWQFSFLQKWITPLVIWQATTPVDVKPWKLSIIKRCAMHPGYRDAPGSATLILQRFQCLVGASSQITESIITINCNRKTLKSHRNLKLDAHFLSILKRILSRAHPANFPADTVQNTIDMYLSEIHQLGADSIYPLRLQSLPEYVPSDSTVSLWDVTSLEQLAQNWPQLHIPNDVDYMMKPSLNSNVLLPRKVMSRDSLKHLYSSIILIKNSRDESSSPYEWCIWQLKRCFAHQIETPQEVIPIIISVSSMDNKLSSRIIQTFCNLKYLKLDELTLKKVCGGILPLWKPELISGTREFFVKFMASIFMWSTRDGHDNNCTFSETCFYVLQMITNWVLDDKLIALGLTLLHDMQSLLTLDKIFNNATSNRFSTMAFISSLDILTQLSKQTKSDYAIQYLIVGPDIMNKVFSSDDPLLLSAACRYLVATKNKLMQYPSTNKFVRMQNQYIMDLTNYLYRNKVLSSKSLFGVSPDFFKQILENLYIPTADFKNAKFFTITGIPALSYICIIILRRLETAENTKIKFTSGIINEETFNNFFRVHHDEIGQHGWIKGVNNIHDLRVKILMHLSNTANPYRDIAAFLFTYLKSLSKYSVQNS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Inner kinetochore subunit MCM22
Molecular weight formula_weight	27602.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MDVEKDVLDVYIKNLENQIGNKRYFLKQAQGAIDEITKRSLDTEGKPVNSEVFTELLRKPMFFSERADPIGFSLTSNFLSLRAQSSSEWLSLMNDQSVDQKAMLLLQNNINSDLKELLRKLQHQMTIMDSKKQDHAHIRTRKARNKELWDSLADFLKGYLVPNLDDNDESIDSLTNEVMLLMKRLIEHDLNLTLNDFSSKTIPIYRLLLRANIITVIEGSTNPGTKYIKLIDFNETSLT

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	Inner kinetochore subunit IML3
Molecular weight formula_weight	28093.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MPYTWKFLGISKQLSLENGIAKLNQLLNLEVDLDIQTIRVPSDPDGGTAADEYIRYEMRLDISNLDEGTYSKFIFLGNSKMEVPMFLCYCGTDNRNEVVLQWLKAEYGVIMWPIKFEQKTMIKLADASIVHVTKENIEQITWFSSKLYFEPETQDKNLRQFSIEIPRESCEGLALGYGNTMHPYNDAIVPYIYNETGMAVERLPLTSVILAGHTKIMRESIVTSTRSLRNRVLAVVLQSIQFTSE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	Inner kinetochore subunit CHL4
Molecular weight formula_weight	52743.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MSNELRLEDNYVPTSDTLVVFKQLMKLPVTVLYDLTLSWFAKFGGSFDGDIYLLTETLDLLIEKGVRRNVIVNRILYVYWPDGLNVFQLAEIDCHLMISKPEKFKWLPSKALRGDGKPYVVKLQPAKFIENLQTDLAKIYHCHVYMFKHPSLPVLITRIQLFDSNNLFLSTPNIGSINKESLYNKLDKFQGKPLISRRPYYVAFPLNSPIIFHSVDKDIYARLVLQSISRTISERETIIFKPVQKIPVKSIHNIMTLLGPSRFAESMGPWECYASANFERSPLHDYKKHQGLTGKKVMVREFDDSFLNDDENFYGKEEPEIRRLRLEKNMIKFKGSANGVMDQKYNDLKEFNEHVHNIRNGKKNEDSGEPVYISRYSSLVPIEKVGFTLKNEINSRIITIKLKFNGNDIFGGLHELCDKNLINIDKVPGWLAGENGSFSGTIMNGDFQREQVAKGGLL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	Inner kinetochore subunit MCM21
Molecular weight formula_weight	43028.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSRIDDLQQDIESLLSEINSLEESREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLNNFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLDLESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIALLGSLDDLELKLNHSFATIFK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	Inner kinetochore subunit CTF19
Molecular weight formula_weight	42841.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MDFTSDTTNSHDTSNSHLSLEDAVGTHHAGEADVNIDGDEKQQLSLLDDDQVRALKLQEEKDALLTRRNTLLQEIQTYQNILMKENNSKTKNGDILQNDITQDFLNLISISSSNPNSAISDRKRVERINGLTNLQKELVTKYDTLPLLNMNLRLSYLRDHTYPHLQVSVQSRDRVHNDGIEVLVVNYKFCRNTMNPFEIQFKMFYKFEDSTLLKWEILRISTNVRLKAKQLLATRNFQKCLLSLYEFDKIKSKKTGIFQNLINLLKRKTRCYLMNNSDSLIVERVIREGRLTTIKLQINFIITMPGERGKPRNCFLPMSKISIALWKGGERFNQIDLDEICYGLIKEYGVKTGLKEICNVCLFPDMYAR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	Inner kinetochore subunit OKP1
Molecular weight formula_weight	47427.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAADRDNFLQNIENDSINNGQAMDLSPNRSSSESDSSILMNVNDIKTLRLDVAPEAKSTQSKKSLFYENSDDAEEGEIEERTNKEEGQYHHKGSKQLRFEVGKESTGKLQSHLSDGSATSGEGNVRPWEFRKVIQAEYRERLPRNYELKHWKKPSKIMIGSILRLLETNTVSALDSVFEKYEKEMNQMTHGDNNEVKRIYSKKERLLEIILTKIKKKLRQAKFPSRISERDLDIEYIYSKRQFIQNRYSQELQNNERLEAILSREQNLLEETRKLCMNLKTNNKKRLTEKLIQKDLHPVLNKAMEYTYGLESTNGFMHPDGPVTFRNDSHELNLMLNDPIKSTADVRLDKEEVLSLLPSLKEYTKKSKELKETMGQMISDSHEEEIKEVFVPHHESHQDKTEEDIH

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	Inner kinetochore subunit CNN1
Molecular weight formula_weight	41359.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MSTPRKAAGNNENTEVSEIRTPFRERALEEQRLKDEVLIRNTPGYRKLLSASTKSHDILNKDPNEVRSFLQDLSQVLARKSQGNDTTTNKTQARNLIDELAYEESQPEENELLRSRSEKLTDNNIGNETQPDYTSLSQTVFAKLQERDKGLKSRKIDPIIIQDVPTTGHEDELTVHSPDKANSISMEVLRTSPSIGMDQVDEPPVRDPVPISITQQEEPLSEDLPSDDKEETEEAENEDYSFENTSDENLDDIGNDPIRLNVPAVRRSSIKPLQIMDLKHLTRQFLNENRIILPKQTWSTIQEESLNIMDFLKQKIGTLQKQELVDSFIDMGIINNVDDMFELAHELLPLELQSRIESYLF

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	Inner kinetochore subunit AME1
Molecular weight formula_weight	37506.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MDRDTKLAFRLRGSHSRRTDDIDDDVIVFKTPNAVYREENSPIQSPVQPILSSPKLANSFEFPITTNNVNAQDRHEHGYQPLDAEDYPMIDSENKSLISESPQNVRNDEDLTTRYNFDDIPIRQLSSSITSVTTIDVLSSLFINLFENDLIPQALKDFNKSDDDQFRKLLYKLDLRLFQTISDQMTRDLKDILDINVSNNELCYQLKQVLARKEDLNQQIISVRNEIQELKAGKDWHDLQNEQAKLNDKVKLNKRLNDLTSTLLGKYEGDRKIMSQDSEDDSIRDDSNILDIAHFVDLMDPYNGLLKKINKINENLSNELQPSL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 13 Entity 13 polymer

Description description	Inner kinetochore subunit WIP1
Molecular weight formula_weight	10255.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MDTEALANYLLRQLSLDAEENKLEDLLQRQNEDQESSQEYNKKLLLACGFQAILRKILLDARTRATAEGLREVYPYHIEAATQAFLDSQ

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 14 Entity 14 polymer

Description description	Inner kinetochore subunit NKP1
Molecular weight formula_weight	27006.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MTDTYNSISNFIENELTALLSSDDYLMDDLAGELPNEVCRLLKAQVIEKRKDAMSRGKQDLLSKEIYDNESELRASQSQQIMELVGDIPKYSLGSELRNRVEGEPQSTSIERLIEDVLKLPQMEVADEEEVEVENDLKVLSEYSNLRKDLILKCQALQIGESKLSDILSQTNSINSLTTSIKEASEDDDISEYFATYNGKLVVALEEMKLLLEEAVKTFGNSPEKREKIKKILSELKK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 15 Entity 15 polymer

Description description	Inner kinetochore subunit NKP2
Molecular weight formula_weight	17877.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MNSEQLLHNYVSDSLLTTLISFQEFKQQLQSYTSDEQQLQHWYELLQARDARVTSELEARIKQFFITLRSRLLRFLESEQLSHSLSLETLIDALYKINDLLQQRLQILDDAIQEKTSELAEFENMVRSPSAGDNAIPGLLQIIQSYINLLEEN

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 16 Entity 16 polymer

Description description	C0N3 DNA
Molecular weight formula_weight	47239.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E

ATAAGTCACATGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAATATTAGTGTATTTGATTTCCGAAAGTTAAAAAAGAAATAGTAAGAAATATATATTTCATTGAA

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	43467

Cryo-EM structure of CBF1-CCAN bound topologically to centromeric DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Centromere-binding protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inner kinetochore subunit MCM16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inner kinetochore subunit CTF3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inner kinetochore subunit MCM22

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inner kinetochore subunit IML3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inner kinetochore subunit CHL4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inner kinetochore subunit MCM21

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inner kinetochore subunit CTF19

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inner kinetochore subunit OKP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Inner kinetochore subunit CNN1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer