8uxz

E. coli acetyl-CoA carboxylase, wide stacked local reconstruction, 3.20 Angstrom

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Biotin carboxyl carrier protein of acetyl-CoA carboxylase × 2 （P0ABD8） Biotin carboxylase × 2 （P24182） Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta × 3 （P0A9Q5） BIOTIN × 2 ADENOSINE-5'-DIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 2 ACETYL COENZYME *A × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACCA_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–316； UniProt 4–319 Author chain E； PDBConstruct 1–316； UniProt 4–319

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

Escherichia coli

UniProt P0ABD8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha × 2 （P0ABD5） Biotin carboxylase × 2 （P24182） Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta × 3 （P0A9Q5） BIOTIN × 2 ADENOSINE-5'-DIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 2 ACETYL COENZYME *A × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCCP_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–77； UniProt 80–156 Author chain F； PDBConstruct 1–77； UniProt 80–156

Biotin carboxylase

Escherichia coli

UniProt P24182

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha × 2 （P0ABD5） Biotin carboxyl carrier protein of acetyl-CoA carboxylase × 2 （P0ABD8） Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta × 3 （P0A9Q5） BIOTIN × 2 ADENOSINE-5'-DIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 2 ACETYL COENZYME *A × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACCC_ECOLI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–446； UniProt 1–446 Author chain G； PDBConstruct 1–446； UniProt 1–446

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta

Escherichia coli

UniProt P0A9Q5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha × 2 （P0ABD5） Biotin carboxyl carrier protein of acetyl-CoA carboxylase × 2 （P0ABD8） Biotin carboxylase × 2 （P24182） BIOTIN × 2 ADENOSINE-5'-DIPHOSPHATE × 2 MAGNESIUM ION × 2 ZINC ION × 2 ACETYL COENZYME *A × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACCD_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–284； UniProt 2–285 Author chain H； PDBConstruct 1–284； UniProt 2–285 Author chain I； PDBConstruct 1–284； UniProt 2–285

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8uxz
Deposition date deposition_date	2023-11-11
Structure title title	E. coli acetyl-CoA carboxylase, wide stacked local reconstruction, 3.20 Angstrom
Keywords keywords	complex, enzyme, biosynthesis of fatty acids, BIOSYNTHETIC PROTEIN; BIOSYNTHETIC PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8uxz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8uxz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8uxz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	53.61 Å
Rg (electron density)	54.05 Å
Total Rg	54.03 Å
Atom count	17474
Residues	2246
Excluded volume	312000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8uxz__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha
Molecular weight formula_weight	34956.1 kDa
EC 编号 ec_number	2.1.3.15
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	17474

NFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGAWQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLADLADLDVLSTEDLKNRRYQRLMSYGYA

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Biotin carboxyl carrier protein of acetyl-CoA carboxylase
Molecular weight formula_weight	8370.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

GHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Biotin carboxylase
Molecular weight formula_weight	49000.2 kDa
EC 编号 ec_number	6.3.4.14
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAIAAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQSISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVVEEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGQPLSIKQEEVHVRGHAVECRINAEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDLQIRIMNDENFQHGGTNIHYLEKKLGL

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta
Molecular weight formula_weight	31234.6 kDa
EC 编号 ec_number	2.1.3.15
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H,I

SWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNRLHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREKLPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNP

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 non-polymer

Description description	BIOTIN
Molecular weight formula_weight	244.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 9 Entity 9 non-polymer

Description description	ACETYL COENZYME *A
Molecular weight formula_weight	809.6 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	809111

E. coli acetyl-CoA carboxylase, wide stacked local reconstruction, 3.20 Angstrom

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

State in the Current Structure

Other States of the Same Protein in the Database

Biotin carboxylase

State in the Current Structure

Other States of the Same Protein in the Database

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8uxz__assembly_1__model_1

8uxz__assembly_1__model_1 | I(q)

8uxz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

7. Citations (1)

E. coli acetyl-CoA carboxylase, wide stacked local reconstruction, 3.20 Angstrom

1. Protein Identity and Related Structures Protein Identity & Related Structures

Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Biotin carboxyl carrier protein of acetyl-CoA carboxylase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Biotin carboxylase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8uxz__assembly_1__model_1

8uxz__assembly_1__model_1 | I(q)

8uxz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

7. Citations (1)