SAXSdb — 8vc3

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain A； UniProt 2–59	Not recorded	Potassium voltage-gated channel subfamily A member 2 × 4 （P63142） K POTASSIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8VC3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1DTX CRYSTAL STRUCTURE OF ALPHA-DENDROTOXIN FROM THE GREEN MAMBA VENOM AND ITS COMPARISON WITH THE STRUCTURE OF BOVINE PANCREATIC TRYPSIN INHIBITOR Deposited 1991-04-29	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–59（58 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	VKTHA_DENAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–59； UniProt 2–59

Potassium voltage-gated channel subfamily A member 2

Rattus norvegicus

UniProt P63142

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain B； UniProt 1–499 Chain C； UniProt 1–499 Chain D； UniProt 1–499 Chain E； UniProt 1–499	Not recorded	Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin × 1 （P00980） K POTASSIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8VC3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1DSX KV1.2 T1 DOMAIN, RESIDUES 33-119, T46V MUTANT Deposited 2000-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain B 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain C 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain D 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；22% PEG 1500, 5 % ISOPROPANOL, 200 MM NA ACETATE, 12 MM SRCL2, 50 MM TRIS, PH 8.5, pH 8.50	Resolution 1.60 Å R-free 0.279
1DSX KV1.2 T1 DOMAIN, RESIDUES 33-119, T46V MUTANT Deposited 2000-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain F 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain G 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain H 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；22% PEG 1500, 5 % ISOPROPANOL, 200 MM NA ACETATE, 12 MM SRCL2, 50 MM TRIS, PH 8.5, pH 8.50	Resolution 1.60 Å R-free 0.279
1QDV N-TERMINAL DOMAIN, VOLTAGE-GATED POTASSIUM CHANNEL KV1.2 RESIDUES 33-131 Deposited 1999-07-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 33–131（99 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 33-131 Chain B 33–131（99 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 33-131 Chain C 33–131（99 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 33-131 Chain D 33–131（99 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 33-131	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；19% PEG 4000, 100 MM NH4 ACETATE, 21% METHANOL, MES PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.60 Å R-free 0.278
1QDW N-TERMINAL DOMAIN, VOLTAGE-GATED POTASSIUM CHANNEL KV1.2 RESIDUES 33-119 Deposited 1999-07-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain B 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain C 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain D 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；9% PEG 1500, 5% N-PROPANOL, 120 MM GDHCL 50 MM MES PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.10 Å R-free 0.266
1QDW N-TERMINAL DOMAIN, VOLTAGE-GATED POTASSIUM CHANNEL KV1.2 RESIDUES 33-119 Deposited 1999-07-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain F 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain G 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain H 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；9% PEG 1500, 5% N-PROPANOL, 120 MM GDHCL 50 MM MES PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.10 Å R-free 0.266
2A79 Mammalian Shaker Kv1.2 potassium channel- beta subunit complex Deposited 2005-07-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 1–499（499 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；peg 400, potassium chloride, tris buffer, EDTA, DTT, TCEP, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.252
3LNM F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel Deposited 2010-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain D 1–266（266 aa） Chain D 303–499（197 aa）	Mutation：C31S, C32S, N207Q, F233W, C431S, C478S Mutation：C31S, C32S, N207Q, F233W, C431S, C478S	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；25-28% PEG 400, 50mM Tris-HCl, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.247
3LNM F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel Deposited 2010-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 303–499（197 aa）	Mutation：C31S, C32S, N207Q, F233W, C431S, C478S Mutation：C31S, C32S, N207Q, F233W, C431S, C478S	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 48 K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；25-28% PEG 400, 50mM Tris-HCl, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.247
3LUT A Structural Model for the Full-length Shaker Potassium Channel Kv1.2 Deposited 2010-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–499（499 aa）	Mutation：N207Q	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å R-free 0.221
4JTA Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 12 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.50 Å R-free 0.236
4JTA Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain Q 1–266（266 aa） Chain Q 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 12 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.50 Å R-free 0.236
4JTC Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+ Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 CS CESIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, Cesium CHLORIDE, TRIS BUFFER, pH 8.9, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.56 Å R-free 0.262
4JTC Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+ Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 1–266（266 aa） Chain H 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 CS CESIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, Cesium CHLORIDE, TRIS BUFFER, pH 8.9, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.56 Å R-free 0.262
4JTD Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.54 Å R-free 0.235
4JTD Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 1–266（266 aa） Chain H 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.54 Å R-free 0.235
5WIE Crystal structure of a Kv1.2-2.1 chimera K+ channel V406W mutant in an inactivated state Deposited 2017-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–42（42 aa）	Mutation：V406W	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 20 K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；293 K；50 mM Tris-Cl pH 8.3, 29-31% PEG400	Resolution 3.30 Å R-free 0.243
5WIE Crystal structure of a Kv1.2-2.1 chimera K+ channel V406W mutant in an inactivated state Deposited 2017-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain H 1–42（42 aa）	Mutation：V406W	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；293 K；50 mM Tris-Cl pH 8.3, 29-31% PEG400	Resolution 3.30 Å R-free 0.243
6EBK The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs Deposited 2018-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 303–499（197 aa） Chain D 1–266（266 aa） Chain D 303–499（197 aa） Chain F 1–266（266 aa） Chain F 303–499（197 aa） Chain H 1–266（266 aa） Chain H 303–499（197 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；A 3 microliter sample was applied to a plasma-cleaned grid and blotted for 10 seconds.	Resolution 3.30 Å
6EBL The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic domain Deposited 2018-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 303–499（197 aa） Chain D 1–266（266 aa） Chain D 303–499（197 aa） Chain F 1–266（266 aa） Chain F 303–499（197 aa） Chain H 1–266（266 aa） Chain H 303–499（197 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；A 3 microliter sample was applied to a plasma-cleaned grid and blotted for 10 seconds.	Resolution 3.00 Å
6EBM The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, transmembrane domain of subunit alpha Deposited 2018-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain B 1–266（266 aa） Chain B 303–499（197 aa） Chain D 1–266（266 aa） Chain D 303–499（197 aa） Chain F 1–266（266 aa） Chain F 303–499（197 aa） Chain H 1–266（266 aa） Chain H 303–499（197 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；A 3 microliter sample was applied to a plasma-cleaned grid and blotted for 10 seconds.	Resolution 4.00 Å
8VC4 Voltage gated potassium ion channel Kv1.2 in Sodium Deposited 2023-12-13	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–499（499 aa） Chain B 1–499（499 aa） Chain C 1–499（499 aa） Chain D 1–499（499 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
8VC6 Voltage gated potassium ion channel Kv1.2 in Potassium Deposited 2023-12-13	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–499（499 aa） Chain B 1–499（499 aa） Chain C 1–499（499 aa） Chain D 1–499（499 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
8VCH Voltage gated potassium ion channel Kv1.2 W366F, C-type inactivated Deposited 2023-12-14	Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–499（499 aa） Chain B 1–499（499 aa） Chain C 1–499（499 aa） Chain D 1–499（499 aa）	Mutation：W366F Mutation：W366F Mutation：W366F Mutation：W366F	K POTASSIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.55 Å

16 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KCNA2_RAT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 38–536； UniProt 1–499 Author chain C； PDBConstruct 38–536； UniProt 1–499 Author chain D； PDBConstruct 38–536； UniProt 1–499 Author chain E； PDBConstruct 38–536； UniProt 1–499

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8vc3
Deposition date deposition_date	2023-12-13
Structure title title	Voltage gated potassium ion channel Kv1.2 in complex with DTx
Keywords keywords	Ion Channel, Toxin bound, Blocker, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	33.93 Å
Radius of gyration Rg (electron density) rg_electron	32.96 Å
Forward intensity I(0) i0	173060000.00
Molecular weight molecular_weight	116030.0 kDa
Excluded volume excluded_volume	149480 Å³
Envelope volume envelope_volume	192620 Å³
Hydration-shell volume shell_volume	47875 Å³
Envelope diameter envelope_diameter	113.0 Å
Shell Rg shell_rg	40.34 Å
Envelope Rg envelope_rg	33.26 Å
Shape Rg shape_rg	33.06 Å
Total Rg total_rg	33.24 Å
Total atoms total_atoms	8219
Residues n_residues	1087
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	107.8 Å
Rg (real space) rg_real	33.79 Å
Rg uncertainty (real space) rg_real_error	0.88 Å
I(0) (real space) i0_real	1.7310e+08
I(0) uncertainty (real space) i0_real_error	2.7690e+06
Rg (reciprocal space) rg_reciprocal	33.88 Å
I(0) (reciprocal space) i0_reciprocal	173100000.0000
Solution quality estimate total_estimate	0.8864
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	45.9 Å
Skewness Skewness skewness	0.169
Kurtosis Kurtosis kurtosis	-0.320
Angular range angular_range	— – 0.2350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	20770000.0000
Real-space data points n_real_points	48
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.859; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.995; Smooth: 0.947

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin
Molecular weight formula_weight	7015.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	8219

GPRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG

Entity 2 Entity 2 polymer

Description description	Potassium voltage-gated channel subfamily A member 2
Molecular weight formula_weight	60591.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,B,C,D

MSAWSHPQFEKGGGSGGGSGGSAWSHPQFEKLVPRGSMTVATGDPVDEAAAHPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGSGVTFHTYSQSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV

来源 Source

来源生物 organism	Rattus norvegicus
通用名 common_name	Rat
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	Komagataella pastoris

Entity 3 Entity 3 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.20 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	312202

fit	/app/data/saxs_computation/vc/8vc3/8vc3.fit
pddf	/app/data/pr_computation/vc/8vc3/8vc3.pr.out
profile	/app/data/saxs_computation/vc/8vc3/8vc3.dat

Voltage gated potassium ion channel Kv1.2 in complex with DTx

1. Protein Identity and Related Structures Protein Identity & Related Structures

Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin

State in the Current Structure

Other States of the Same Protein in the Database

Potassium voltage-gated channel subfamily A member 2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)