SAXSdb — 3lnm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Voltage-gated potassium channel subunit beta-2

Rattus norvegicus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain A； UniProt 36–367	Fragment：subunit beta-2 core	F233W mutant of the Kv2.1 paddle-Kv1.2 chimera × 4 （P63142,P15387） NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293 K；25-28% PEG 400, 50mM Tris-HCl, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.247
2	Insufficient information Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain C； UniProt 36–367	Fragment：subunit beta-2 core	F233W mutant of the Kv2.1 paddle-Kv1.2 chimera × 4 （P63142,P15387） NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 48 K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293 K；25-28% PEG 400, 50mM Tris-HCl, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.247

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3LNM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EXB STRUCTURE OF THE CYTOPLASMIC BETA SUBUNIT-T1 ASSEMBLY OF VOLTAGE-DEPENDENT K CHANNELS Deposited 2000-05-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 36–367（332 aa） Fragment：BETA SUBUNIT, RESIDUES 36-367	Not recorded	NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.6；277 K；Peg 4000, glycine, pH 8.6, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.10 Å R-free 0.227
1QRQ STRUCTURE OF A VOLTAGE-DEPENDENT K+ CHANNEL BETA SUBUNIT Deposited 1999-06-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 36–360（325 aa） Fragment：BETA SUBUNIT CORE Chain B 36–360（325 aa） Fragment：BETA SUBUNIT CORE Chain C 36–360（325 aa） Fragment：BETA SUBUNIT CORE Chain D 36–360（325 aa） Fragment：BETA SUBUNIT CORE	Not recorded	NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.50	Resolution 2.80 Å R-free 0.242
1QRQ STRUCTURE OF A VOLTAGE-DEPENDENT K+ CHANNEL BETA SUBUNIT Deposited 1999-06-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 36–360（325 aa） Fragment：BETA SUBUNIT CORE Chain B 36–360（325 aa） Fragment：BETA SUBUNIT CORE Chain C 36–360（325 aa） Fragment：BETA SUBUNIT CORE Chain D 36–360（325 aa） Fragment：BETA SUBUNIT CORE	Not recorded	NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 8	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.50	Resolution 2.80 Å R-free 0.242
2A79 Mammalian Shaker Kv1.2 potassium channel- beta subunit complex Deposited 2005-07-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；peg 400, potassium chloride, tris buffer, EDTA, DTT, TCEP, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.252
2R9R Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel) in association with beta subunit Deposited 2007-09-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；peg 400, potassium chloride, tris buffer, EDTA, DTT, TCEP, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.40 Å R-free 0.244
2R9R Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel) in association with beta subunit Deposited 2007-09-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain G 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；peg 400, potassium chloride, tris buffer, EDTA, DTT, TCEP, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.40 Å R-free 0.244
2R9R Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel) in association with beta subunit Deposited 2007-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain A 36–367（332 aa） Chain G 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 8 K POTASSIUM ION × 32 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 68	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；peg 400, potassium chloride, tris buffer, EDTA, DTT, TCEP, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.40 Å R-free 0.244
2R9R Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel) in association with beta subunit Deposited 2007-09-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；peg 400, potassium chloride, tris buffer, EDTA, DTT, TCEP, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.40 Å R-free 0.244
2R9R Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel) in association with beta subunit Deposited 2007-09-13	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain G 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；peg 400, potassium chloride, tris buffer, EDTA, DTT, TCEP, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293.0K	Resolution 2.40 Å R-free 0.244
3EAU Voltage-dependent K+ channel beta subunit in complex with cortisone Deposited 2008-08-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 36–361（326 aa） Fragment：cytoplasmic Kvbeta subunit	Not recorded	NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PDN 17,21-DIHYDROXYPREGNA-1,4-DIENE-3,11,20-TRIONE × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；6-15% glycerol, 1.5 M ammonium sulfate, 0.1 M Tris, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 1.82 Å R-free 0.206
3EB3 Voltage-dependent K+ channel beta subunit (W121A) in complex with cortisone Deposited 2008-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 36–361（326 aa） Fragment：cytoplasmic Kvbeta subunit	Mutation：W121A	NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PDN 17,21-DIHYDROXYPREGNA-1,4-DIENE-3,11,20-TRIONE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；6-15% glycerol, 1.5 M ammonium sulfate, 0.1 M Tris, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.00 Å R-free 0.249
3EB4 Voltage-dependent K+ channel beta subunit (I211R) in complex with cortisone Deposited 2008-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 36–361（326 aa） Fragment：cytoplasmic Kvbeta subunit	Mutation：I211R	NDP NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PDN 17,21-DIHYDROXYPREGNA-1,4-DIENE-3,11,20-TRIONE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；6-15% glycerol, 1.5 M ammonium sulfate, 0.1 M Tris, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.00 Å R-free 0.256
3LUT A Structural Model for the Full-length Shaker Potassium Channel Kv1.2 Deposited 2010-02-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–367（367 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å R-free 0.221
4JTA Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin Deposited 2013-03-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 12 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.50 Å R-free 0.236
4JTA Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin Deposited 2013-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain P 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 12 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.50 Å R-free 0.236
4JTC Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+ Deposited 2013-03-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 CS CESIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, Cesium CHLORIDE, TRIS BUFFER, pH 8.9, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.56 Å R-free 0.262
4JTC Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+ Deposited 2013-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 CS CESIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, Cesium CHLORIDE, TRIS BUFFER, pH 8.9, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.56 Å R-free 0.262
4JTD Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of Charybdotoxin Deposited 2013-03-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.54 Å R-free 0.235
4JTD Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of Charybdotoxin Deposited 2013-03-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.54 Å R-free 0.235
5WIE Crystal structure of a Kv1.2-2.1 chimera K+ channel V406W mutant in an inactivated state Deposited 2017-07-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 20 K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；293 K；50 mM Tris-Cl pH 8.3, 29-31% PEG400	Resolution 3.30 Å R-free 0.243
5WIE Crystal structure of a Kv1.2-2.1 chimera K+ channel V406W mutant in an inactivated state Deposited 2017-07-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain G 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；293 K；50 mM Tris-Cl pH 8.3, 29-31% PEG400	Resolution 3.30 Å R-free 0.243
6CI1 The Structure of Full-Length Kv Beta 2.1 Determined by Cryogenic Electron Microscopy Deposited 2018-02-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 36–361（326 aa） Chain B 36–361（326 aa） Chain C 36–361（326 aa） Chain D 36–361（326 aa） Chain E 36–361（326 aa） Chain F 36–361（326 aa） Chain G 36–361（326 aa） Chain H 36–361（326 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.90 Å
6EBK The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs Deposited 2018-08-06	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 37–367（331 aa） Chain C 37–367（331 aa） Chain E 37–367（331 aa） Chain G 37–367（331 aa）	Mutation：cytosolic domain (UNP residues 37-367) Mutation：cytosolic domain (UNP residues 37-367) Mutation：cytosolic domain (UNP residues 37-367) Mutation：cytosolic domain (UNP residues 37-367)	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；A 3 microliter sample was applied to a plasma-cleaned grid and blotted for 10 seconds.	Resolution 3.30 Å
6EBL The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic domain Deposited 2018-08-06	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain A 37–367（331 aa） Chain C 37–367（331 aa） Chain E 37–367（331 aa） Chain G 37–367（331 aa）	Mutation：cytosolic domain (UNP residues 37-367) Mutation：cytosolic domain (UNP residues 37-367) Mutation：cytosolic domain (UNP residues 37-367) Mutation：cytosolic domain (UNP residues 37-367)	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；A 3 microliter sample was applied to a plasma-cleaned grid and blotted for 10 seconds.	Resolution 3.00 Å
7SIT Crystal structure of Voltage gated potassium ion channel, Kv 1.2 chimera-3m Deposited 2021-10-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 8 O OXYGEN ATOM × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；50 mM Tris, pH 8.5, 28-32% PEG400, CHAPS	Resolution 3.32 Å R-free 0.289
7SIT Crystal structure of Voltage gated potassium ion channel, Kv 1.2 chimera-3m Deposited 2021-10-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；50 mM Tris, pH 8.5, 28-32% PEG400, CHAPS	Resolution 3.32 Å R-free 0.289
7SIZ C-type inactivation in a voltage gated K+ channel Deposited 2021-10-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；293 K；50 mM Tris, pH 8.6, 28-30% PEG400, 8 mM CHAPS	Resolution 3.10 Å R-free 0.265
7SIZ C-type inactivation in a voltage gated K+ channel Deposited 2021-10-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 36–367（332 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；293 K；50 mM Tris, pH 8.6, 28-30% PEG400, 8 mM CHAPS	Resolution 3.10 Å R-free 0.265

17 other PDB entries and 28 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KCAB2_RAT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–333； UniProt 36–367 Author chain C； PDBConstruct 2–333； UniProt 36–367

F233W mutant of the Kv2.1 paddle-Kv1.2 chimera

Rattus norvegicus

UniProt P15387

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain D； UniProt 274–305	Mutation：C31S, C32S, N207Q, F233W, C431S, C478S	Voltage-gated potassium channel subunit beta-2 × 4 （P62483） NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293 K；25-28% PEG 400, 50mM Tris-HCl, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.247
2	Insufficient information Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain B； UniProt 274–305	Mutation：C31S, C32S, N207Q, F233W, C431S, C478S	Voltage-gated potassium channel subunit beta-2 × 4 （P62483） NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 48 K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293 K；25-28% PEG 400, 50mM Tris-HCl, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.247

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3LNM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4JTA Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 274–306（33 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 12 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.50 Å R-free 0.236
4JTA Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain Q 274–306（33 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 12 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.50 Å R-free 0.236
4JTC Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+ Deposited 2013-03-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 274–306（33 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 CS CESIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, Cesium CHLORIDE, TRIS BUFFER, pH 8.9, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.56 Å R-free 0.262
4JTC Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+ Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 274–306（33 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 CS CESIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, Cesium CHLORIDE, TRIS BUFFER, pH 8.9, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.56 Å R-free 0.262
4JTD Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 274–306（33 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.54 Å R-free 0.235
4JTD Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 274–306（33 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.54 Å R-free 0.235
8SD3 CryoEM structure of rat Kv2.1(1-598) wild type in nanodiscs Deposited 2023-04-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 5–602（598 aa） Chain B 5–602（598 aa） Chain C 5–602（598 aa） Chain D 5–602（598 aa）	Not recorded	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 24 K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
8SDA CryoEM structure of rat Kv2.1(1-598) L403A mutant in nanodiscs Deposited 2023-04-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 5–602（598 aa） Chain B 5–602（598 aa） Chain C 5–602（598 aa） Chain D 5–602（598 aa）	Mutation：L403A Mutation：L403A Mutation：L403A Mutation：L403A	POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 15 K POTASSIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å

5 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KCNB1_RAT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 286–317； UniProt 274–305 Author chain D； PDBConstruct 286–317； UniProt 274–305

F233W mutant of the Kv2.1 paddle-Kv1.2 chimera

Rattus norvegicus

UniProt P63142

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain D； UniProt 1–266 Chain D； UniProt 303–499	Mutation：C31S, C32S, N207Q, F233W, C431S, C478S	Voltage-gated potassium channel subunit beta-2 × 4 （P62483） NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293 K；25-28% PEG 400, 50mM Tris-HCl, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.247
2	Insufficient information Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain B； UniProt 1–266 Chain B； UniProt 303–499	Mutation：C31S, C32S, N207Q, F233W, C431S, C478S	Voltage-gated potassium channel subunit beta-2 × 4 （P62483） NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 48 K POTASSIUM ION × 20	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293 K；25-28% PEG 400, 50mM Tris-HCl, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.247

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3LNM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1DSX KV1.2 T1 DOMAIN, RESIDUES 33-119, T46V MUTANT Deposited 2000-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain B 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain C 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain D 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；22% PEG 1500, 5 % ISOPROPANOL, 200 MM NA ACETATE, 12 MM SRCL2, 50 MM TRIS, PH 8.5, pH 8.50	Resolution 1.60 Å R-free 0.279
1DSX KV1.2 T1 DOMAIN, RESIDUES 33-119, T46V MUTANT Deposited 2000-01-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain F 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain G 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119 Chain H 33–119（87 aa） Fragment：N-TERMINAL ASSEMBLY DOMAIN, RESIDUES 33-119	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；22% PEG 1500, 5 % ISOPROPANOL, 200 MM NA ACETATE, 12 MM SRCL2, 50 MM TRIS, PH 8.5, pH 8.50	Resolution 1.60 Å R-free 0.279
1QDV N-TERMINAL DOMAIN, VOLTAGE-GATED POTASSIUM CHANNEL KV1.2 RESIDUES 33-131 Deposited 1999-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 33–131（99 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 33-131 Chain B 33–131（99 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 33-131 Chain C 33–131（99 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 33-131 Chain D 33–131（99 aa） Fragment：N-TERMINAL DOMAIN, RESIDUES 33-131	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；19% PEG 4000, 100 MM NH4 ACETATE, 21% METHANOL, MES PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.60 Å R-free 0.278
1QDW N-TERMINAL DOMAIN, VOLTAGE-GATED POTASSIUM CHANNEL KV1.2 RESIDUES 33-119 Deposited 1999-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain B 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain C 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain D 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；9% PEG 1500, 5% N-PROPANOL, 120 MM GDHCL 50 MM MES PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.10 Å R-free 0.266
1QDW N-TERMINAL DOMAIN, VOLTAGE-GATED POTASSIUM CHANNEL KV1.2 RESIDUES 33-119 Deposited 1999-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain F 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain G 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE) Chain H 33–119（87 aa） Fragment：N-TERMINAL DOMAIN KV1.2, RESIDUES 33-119 (CORE)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；9% PEG 1500, 5% N-PROPANOL, 120 MM GDHCL 50 MM MES PH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.10 Å R-free 0.266
2A79 Mammalian Shaker Kv1.2 potassium channel- beta subunit complex Deposited 2005-07-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 1–499（499 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；peg 400, potassium chloride, tris buffer, EDTA, DTT, TCEP, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.90 Å R-free 0.252
3LUT A Structural Model for the Full-length Shaker Potassium Channel Kv1.2 Deposited 2010-02-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–499（499 aa）	Mutation：N207Q	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 24	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å R-free 0.221
4JTA Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 12 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.50 Å R-free 0.236
4JTA Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain Q 1–266（266 aa） Chain Q 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 12 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.50 Å R-free 0.236
4JTC Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+ Deposited 2013-03-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 CS CESIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, Cesium CHLORIDE, TRIS BUFFER, pH 8.9, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.56 Å R-free 0.262
4JTC Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+ Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 1–266（266 aa） Chain H 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 CS CESIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, Cesium CHLORIDE, TRIS BUFFER, pH 8.9, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.56 Å R-free 0.262
4JTD Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 64	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.54 Å R-free 0.235
4JTD Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of Charybdotoxin Deposited 2013-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 1–266（266 aa） Chain H 304–499（196 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 K POTASSIUM ION × 16 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.9；293 K；PEG 400, POTASSIUM CHLORIDE, TRIS , pH 8.9, vapor diffusion, hanging drop, temperature 293K	Resolution 2.54 Å R-free 0.235
5WIE Crystal structure of a Kv1.2-2.1 chimera K+ channel V406W mutant in an inactivated state Deposited 2017-07-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–42（42 aa）	Mutation：V406W	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 20 K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；293 K；50 mM Tris-Cl pH 8.3, 29-31% PEG400	Resolution 3.30 Å R-free 0.243
5WIE Crystal structure of a Kv1.2-2.1 chimera K+ channel V406W mutant in an inactivated state Deposited 2017-07-19	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain H 1–42（42 aa）	Mutation：V406W	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4 PGW (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 4 K POTASSIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8；293 K；50 mM Tris-Cl pH 8.3, 29-31% PEG400	Resolution 3.30 Å R-free 0.243
6EBK The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs Deposited 2018-08-06	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 303–499（197 aa） Chain D 1–266（266 aa） Chain D 303–499（197 aa） Chain F 1–266（266 aa） Chain F 303–499（197 aa） Chain H 1–266（266 aa） Chain H 303–499（197 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；A 3 microliter sample was applied to a plasma-cleaned grid and blotted for 10 seconds.	Resolution 3.30 Å
6EBL The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, cytosolic domain Deposited 2018-08-06	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 8 PDB declaration: octameric	Chain B 1–266（266 aa） Chain B 303–499（197 aa） Chain D 1–266（266 aa） Chain D 303–499（197 aa） Chain F 1–266（266 aa） Chain F 303–499（197 aa） Chain H 1–266（266 aa） Chain H 303–499（197 aa）	Not recorded	NAP NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；A 3 microliter sample was applied to a plasma-cleaned grid and blotted for 10 seconds.	Resolution 3.00 Å
6EBM The voltage-activated Kv1.2-2.1 paddle chimera channel in lipid nanodiscs, transmembrane domain of subunit alpha Deposited 2018-08-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain B 1–266（266 aa） Chain B 303–499（197 aa） Chain D 1–266（266 aa） Chain D 303–499（197 aa） Chain F 1–266（266 aa） Chain F 303–499（197 aa） Chain H 1–266（266 aa） Chain H 303–499（197 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；A 3 microliter sample was applied to a plasma-cleaned grid and blotted for 10 seconds.	Resolution 4.00 Å
8VC3 Voltage gated potassium ion channel Kv1.2 in complex with DTx Deposited 2023-12-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–499（499 aa） Chain C 1–499（499 aa） Chain D 1–499（499 aa） Chain E 1–499（499 aa）	Not recorded	K POTASSIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8VC4 Voltage gated potassium ion channel Kv1.2 in Sodium Deposited 2023-12-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–499（499 aa） Chain B 1–499（499 aa） Chain C 1–499（499 aa） Chain D 1–499（499 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
8VC6 Voltage gated potassium ion channel Kv1.2 in Potassium Deposited 2023-12-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–499（499 aa） Chain B 1–499（499 aa） Chain C 1–499（499 aa） Chain D 1–499（499 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.17 Å
8VCH Voltage gated potassium ion channel Kv1.2 W366F, C-type inactivated Deposited 2023-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–499（499 aa） Chain B 1–499（499 aa） Chain C 1–499（499 aa） Chain D 1–499（499 aa）	Mutation：W366F Mutation：W366F Mutation：W366F Mutation：W366F	K POTASSIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.55 Å

16 other PDB entries and 22 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KCNA2_RAT
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 20–285； UniProt 1–266 Author chain B； PDBConstruct 318–514； UniProt 303–499 Author chain D； PDBConstruct 20–285； UniProt 1–266 Author chain D； PDBConstruct 318–514； UniProt 303–499

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3lnm
Deposition date deposition_date	2010-02-02
Structure title title	F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel
Keywords keywords	;voltage-gated potassium channel-beta subunit complex, Acetylation, Cytoplasm, Ion transport, Ionic channel, NADP, Phosphoprotein, Potassium, Potassium transport, Transport, Voltage-gated channel, Glycoprotein, Lipoprotein, Membrane, Palmitate, Potassium channel, Transmembrane, MEMBRANE PROTEIN, TRANSPORT PROTEIN ;; MEMBRANE PROTEIN, TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	82.30 Å
Radius of gyration Rg (electron density) rg_electron	85.32 Å
Forward intensity I(0) i0	319678000.00
Molecular weight molecular_weight	157340.0 kDa
Excluded volume excluded_volume	199930 Å³
Envelope volume envelope_volume	369730 Å³
Hydration-shell volume shell_volume	44982 Å³
Envelope diameter envelope_diameter	296.5 Å
Shell Rg shell_rg	54.41 Å
Envelope Rg envelope_rg	85.21 Å
Shape Rg shape_rg	85.29 Å
Total Rg total_rg	84.62 Å
Total atoms total_atoms	11065
Residues n_residues	1359
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	271.9 Å
Rg (real space) rg_real	83.85 Å
Rg uncertainty (real space) rg_real_error	3.30 Å
I(0) (real space) i0_real	3.1930e+08
I(0) uncertainty (real space) i0_real_error	7.6620e+06
Rg (reciprocal space) rg_reciprocal	75.51 Å
I(0) (reciprocal space) i0_reciprocal	313800000.0000
Solution quality estimate total_estimate	0.6461
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	4
Primary peak position r_peak_primary	28.6 Å
Skewness Skewness skewness	0.611
Kurtosis Kurtosis kurtosis	-0.434
Angular range angular_range	— – 0.0950 Å⁻¹
Current regularization parameter α current_alpha	0.0019
Highest regularization parameter α highest_alpha	9118000.0000
Real-space data points n_real_points	20
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.109; Stabil: 0.971; Sysdev: 1.000; Positv: 1.000; Valcen: 0.164; Smooth: 0.988

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Voltage-gated potassium channel subunit beta-2
Molecular weight formula_weight	37353.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	11308

MLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPYSKKDYRS

来源 Source

来源生物 organism	Rattus norvegicus
通用名 common_name	brown rat,rat,rats
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	pichia pastoris

Entity 2 Entity 2 polymer

Description description	F233W mutant of the Kv2.1 paddle-Kv1.2 chimera
Molecular weight formula_weight	58860.7 kDa
Mutation mutation	C31S, C32S, N207Q, F233W, C431S, C478S
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

MAHHHHHHHHHHGLVPRGSMTVATGDPVDEAAALPGHPQDTYDPEADHESSERVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGEEAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSFCLETLPIFRDENEDMHGGGVTFHTYSQSTIGYQQSTSFTDPFFIVETLCIIWWSFEFLVRFFACPSKAGFFTNIMNIIDIVAIIPYYVTIFLTESNKSVLQFQNVRRVVQIFRIMRILRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPSIPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYLQVTSSPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTANSTLANTNYVNITKMLTDV

来源 Source

来源生物 organism	Rattus norvegicus
通用名 common_name	brown rat,rat,rats
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	Pichia pastoris

Entity 3 Entity 3 non-polymer

Description description	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	743.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate
Molecular weight formula_weight	749.0 kDa
Source method src_method	syn
Copy count entity_count	13

Entity 5 Entity 5 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	243

▼

7. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3lnma_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.1 — TIM beta/alpha-barrel
Superfamily Superfamily superfamily	c.1.7 — NAD(P)-linked oxidoreductase
Family Family family	c.1.7.1 — Aldo-keto reductases (NADP)

Domain ID domain_id	d3lnmc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.1 — TIM beta/alpha-barrel
Superfamily Superfamily superfamily	c.1.7 — NAD(P)-linked oxidoreductase
Family Family family	c.1.7.1 — Aldo-keto reductases (NADP)

CATH v4.4 (8 domains)

Domain ID domain_id	3lnmA00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	100 — NADP-dependent oxidoreductase domain

Domain ID domain_id	3lnmB01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	3lnmB02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	350 — Voltage-gated potassium channels. Chain C

Domain ID domain_id	3lnmB03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	3lnmC00
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	100 — NADP-dependent oxidoreductase domain

Domain ID domain_id	3lnmD01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	3lnmD02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	350 — Voltage-gated potassium channels. Chain C

Domain ID domain_id	3lnmD03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	144.271 Å
Unit-cell length b length_b	144.271 Å
Unit-cell length c length_c	284.060 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 4 21 2
Space-group number int_tables_number	90
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	49.640 Å
R factor r_factor	0.2110
R_work r_work	0.2110
R_free r_free	0.2470

fit	/app/data/saxs_computation/ln/3lnm/3lnm.fit
pddf	/app/data/pr_computation/ln/3lnm/3lnm.pr.out
profile	/app/data/saxs_computation/ln/3lnm/3lnm.dat

F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel

1. Protein Identity and Related Structures Protein Identity & Related Structures

Voltage-gated potassium channel subunit beta-2

State in the Current Structure

Other States of the Same Protein in the Database

F233W mutant of the Kv2.1 paddle-Kv1.2 chimera

State in the Current Structure

Other States of the Same Protein in the Database

F233W mutant of the Kv2.1 paddle-Kv1.2 chimera

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (2 domains)

CATH v4.4 (8 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)