SAXSdb — 8zrt

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Endothelin receptor type B

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain R； UniProt 66–407	Not recorded	Endothelin-1 × 1 （P05305）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.62 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ZRT	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5X93 Human endothelin receptor type-B in complex with antagonist K-8794 Deposited 2017-03-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：R124Y,D154A,K270A,C1054A,I1094R,S342A,I381A,C396A,C400A,C405A Mutation：R124Y,D154A,K270A,C1054A,I1094R,S342A,I381A,C396A,C400A,C405A	K87 3-[6-[(4-tert-butylphenyl)sulfonylamino]-5-(2-methoxyphenoxy)-2-pyrimidin-2-yl-pyrimidin-4-yl]oxy-N-(2,6-dimethylphenyl)propanamide × 1 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 11 CLR CHOLESTEROL × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6；293 K；PEG 500 DME, (NH4)2SO4, MOPS	Resolution 2.20 Å R-free 0.239
5XPR Human endothelin receptor type-B in complex with antagonist bosentan Deposited 2017-06-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：R124Y,K270A,C1054A,I1094R,S342A,I381A,C396A,C400A,C405A Mutation：R124Y,K270A,C1054A,I1094R,S342A,I381A,C396A,C400A,C405A	K86 4-tert-butyl-N-[6-(2-hydroxyethyloxy)-5-(2-methoxyphenoxy)-2-pyrimidin-2-yl-pyrimidin-4-yl]benzenesulfonamide × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6；293 K；PEG 500 DME, Na2SO4, MOPS	Resolution 3.60 Å R-free 0.297
6IGK Crystal Structure of human ETB receptor in complex with Endothelin-3 Deposited 2018-09-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A	OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 12 CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6；293 K；PEG 500DME, Ammonium citrate tribasic	Resolution 2.00 Å R-free 0.227
6IGL Crystal Structure of human ETB receptor in complex with IRL1620 Deposited 2018-09-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A	CIT CITRIC ACID × 1 SO4 SULFATE ION × 4 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 3	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 5；293 K；PEG 500DME, (NH4)2SO4 or NH4Cl	Resolution 2.70 Å R-free 0.241
6K1Q Human endothelin receptor type-B in complex with inverse agonist IRL2500 Deposited 2019-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：;R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A,R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A,R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A ; Mutation：;R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A,R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A,R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A ;	D2U (2~{S})-2-[[(2~{R})-2-[(3,5-dimethylphenyl)carbonyl-methyl-amino]-3-(4-phenylphenyl)propanoyl]amino]-3-(1~{H}-indol-3-yl)propanoic acid × 1 PO4 PHOSPHATE ION × 4 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 8	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 7.5；293 K；30% PEG300, 150 mM NaH2PO4,10 mM TCEP, 100 mM Bis-tris	Resolution 2.70 Å R-free 0.265
6LRY Crystal structure of human endothelin ETB receptor in complex with sarafotoxin S6b Deposited 2020-01-16	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 5；293 K；PEG 600, Ammonium sulfate	Resolution 3.00 Å R-free 0.304
8HBD Cryo-EM structure of IRL1620-bound ETBR-Gi complex Deposited 2022-10-28	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 27–424（398 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.04 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.99 Å
8HCX Cryo-EM structure of Endothelin1-bound ETBR-Gq complex Deposited 2022-11-03	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 27–424（398 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8XVE Cryo-EM structure of ETBR bound with BQ3020 Deposited 2024-01-15	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 67–406（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8XVH Cryo-EM structure of ETBR bound with Endothelin1 Deposited 2024-01-15	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 67–406（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
8XWP Cryo-EM structure of ET-1 bound ETBR-DNGI complex Deposited 2024-01-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 66–407（342 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.21 Å
8XWQ Cryo-EM structure of ET-1 bound ETBR-DNGI complex Deposited 2024-01-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 66–407（342 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EDNRB_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain R； PDBConstruct 5–346； UniProt 66–407

Endothelin-1

Homo sapiens

UniProt P05305

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain L； UniProt 53–73	Not recorded	Endothelin receptor type B × 1 （P24530）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.62 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8ZRT	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EDN HUMAN ENDOTHELIN-1 Deposited 1994-09-19	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 53–73（21 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.18 Å
1EDP CONFORMATIONAL ISOMERISM OF ENDOTHELIN IN ACIDIC AQUEOUS MEDIA: A QUANTITATIVE NOESY ANALYSIS Deposited 1991-12-16	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 53–69（17 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1T7H X-ray structure of [Lys(-2)-Arg(-1)-des(17-21)]-endothelin-1 peptide Deposited 2004-05-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 51–68（18 aa） Chain B 51–68（18 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 5；291 K；PEG 4000, isopropanol, sodium citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 291.0K, pH 5.00	Resolution 1.13 Å R-free 0.134
1V6R Solution Structure of Endothelin-1 with its C-terminal Folding Deposited 2003-12-03	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 53–73（21 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 3；297.7 K；Ionic strength (raw mmCIF value) 5% acetic acid；Pressure ambient NMR sample composition 2.5mM Endothelin-1 \| 90% H2O, 5% D2O, 5% deuterated acetic acid	Resolution not provided
5GLH Human endothelin receptor type-B in complex with ET-1 Deposited 2016-07-11	Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 53–73（21 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6；293 K；PEG 400, MES, (NH4)2SO4, 1,4-butanediol	Resolution 2.80 Å R-free 0.277
6DK5 The X-ray crystal structure of human endothelin-1, a polypeptide hormone regulator of blood pressure Deposited 2018-05-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 53–73（21 aa） Fragment：UNP residues 53-73	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；310 K；4 uL 15 mg/mL aqueous endothelin + 6 uL reservoir solution (20-25% MPD, 0.2 M MES, pH 6.5) + 2 uL 0.2 M MES, pH 6.5	Resolution 1.85 Å R-free 0.284
6DK5 The X-ray crystal structure of human endothelin-1, a polypeptide hormone regulator of blood pressure Deposited 2018-05-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 53–73（21 aa） Fragment：UNP residues 53-73	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；310 K；4 uL 15 mg/mL aqueous endothelin + 6 uL reservoir solution (20-25% MPD, 0.2 M MES, pH 6.5) + 2 uL 0.2 M MES, pH 6.5	Resolution 1.85 Å R-free 0.284
8HCQ Cryo-EM structure of endothelin1-bound ETAR-Gq complex Deposited 2022-11-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain L 53–73（21 aa） Fragment：UNP residues 53-73	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.01 Å
8HCX Cryo-EM structure of Endothelin1-bound ETBR-Gq complex Deposited 2022-11-03	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 53–73（21 aa） Fragment：UNP residues 53-73	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8IY5 ETB-Gi complex bound to endothelin-1 Deposited 2023-04-04	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain L 53–73（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8IY6 ETB-Gi complex bound to Endotheline-1, focused on receptor Deposited 2023-04-04	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 53–73（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.13 Å
8XGR ETB-eGt complex bound to endothelin-1 Deposited 2023-12-15	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain L 53–73（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8XVH Cryo-EM structure of ETBR bound with Endothelin1 Deposited 2024-01-15	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain T 53–73（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
8XVI Cryo-EM structure of ETAR bound with Endothelin1 Deposited 2024-01-15	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain T 53–73（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.32 Å
8XWP Cryo-EM structure of ET-1 bound ETBR-DNGI complex Deposited 2024-01-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain L 53–73（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.21 Å
8XWQ Cryo-EM structure of ET-1 bound ETBR-DNGI complex Deposited 2024-01-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain L 53–73（21 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å

15 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EDN1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain L； PDBConstruct 1–21； UniProt 53–73

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8zrt
Deposition date deposition_date	2024-06-05
Structure title title	Cryo-EM structure focused on the receptor of the ET-1 bound ETBR-DNGI complex
Keywords keywords	ENDOTHELIN, RECEPTOR, Gi, COMPLEX, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	21.74 Å
Radius of gyration Rg (electron density) rg_electron	20.62 Å
Forward intensity I(0) i0	15791200.00
Molecular weight molecular_weight	33004.0 kDa
Excluded volume excluded_volume	42636 Å³
Envelope volume envelope_volume	49744 Å³
Hydration-shell volume shell_volume	20589 Å³
Envelope diameter envelope_diameter	74.0 Å
Shell Rg shell_rg	26.85 Å
Envelope Rg envelope_rg	21.09 Å
Shape Rg shape_rg	20.61 Å
Total Rg total_rg	21.63 Å
Total atoms total_atoms	2322
Residues n_residues	303
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	72.2 Å
Rg (real space) rg_real	21.82 Å
Rg uncertainty (real space) rg_real_error	0.53 Å
I(0) (real space) i0_real	1.5790e+07
I(0) uncertainty (real space) i0_real_error	2.0360e+05
Rg (reciprocal space) rg_reciprocal	21.81 Å
I(0) (reciprocal space) i0_reciprocal	15790000.0000
Solution quality estimate total_estimate	0.6042
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	23.7 Å
Skewness Skewness skewness	0.466
Kurtosis Kurtosis kurtosis	-0.264
Angular range angular_range	— – 0.3650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	4216000.0000
Real-space data points n_real_points	68
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.769; Stabil: 0.999; Sysdev: 0.207; Positv: 1.000; Valcen: 0.929; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Endothelin receptor type B
Molecular weight formula_weight	38808.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R
Atom count atom_count	2322

PGGGLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLYIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNAFKSALCCWAQS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Endothelin-1
Molecular weight formula_weight	2498.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

CSCSSLMDKECVYFCHLDIIW

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.62 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	401671

fit	/app/data/saxs_computation/zr/8zrt/8zrt.fit
pddf	/app/data/pr_computation/zr/8zrt/8zrt.pr.out
profile	/app/data/saxs_computation/zr/8zrt/8zrt.dat

Cryo-EM structure focused on the receptor of the ET-1 bound ETBR-DNGI complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Endothelin receptor type B

State in the Current Structure

Other States of the Same Protein in the Database

Endothelin-1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)