9b1e

Cryo-EM structure of native SWR1 bound to nucleosome (composite structure)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vacuolar protein sorting-associated protein 72

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	Helicase SWR1 × 1 Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 RuvB-like protein 2 × 3 （Q12464） SWR1-complex protein 3 × 1 （P31376） Histone H2A × 2 （A0A6A5Q1K4） Histone H2B × 2 （A0A6A5PZQ7） Histone H3 × 2 （P02299） Histone H4 × 2 （A0A0B4KFZ9） DNA (214-MER) × 1 DNA (214-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VPS72_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–795； UniProt 1–795

Actin-like protein ARP6

OrganismNot specified

UniProt Q12509

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	Helicase SWR1 × 1 Vacuolar protein sorting-associated protein 72 × 1 （Q03388） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 RuvB-like protein 2 × 3 （Q12464） SWR1-complex protein 3 × 1 （P31376） Histone H2A × 2 （A0A6A5Q1K4） Histone H2B × 2 （A0A6A5PZQ7） Histone H3 × 2 （P02299） Histone H4 × 2 （A0A0B4KFZ9） DNA (214-MER) × 1 DNA (214-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP6_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–438； UniProt 1–438

Vacuolar protein sorting-associated protein 71

OrganismNot specified

UniProt Q03433

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	Helicase SWR1 × 1 Vacuolar protein sorting-associated protein 72 × 1 （Q03388） Actin-like protein ARP6 × 1 （Q12509） RuvB-like protein 1 × 3 RuvB-like protein 2 × 3 （Q12464） SWR1-complex protein 3 × 1 （P31376） Histone H2A × 2 （A0A6A5Q1K4） Histone H2B × 2 （A0A6A5PZQ7） Histone H3 × 2 （P02299） Histone H4 × 2 （A0A0B4KFZ9） DNA (214-MER) × 1 DNA (214-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VPS71_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–280； UniProt 1–280

RuvB-like protein 2

OrganismNot specified

UniProt Q12464

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	Helicase SWR1 × 1 Vacuolar protein sorting-associated protein 72 × 1 （Q03388） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 SWR1-complex protein 3 × 1 （P31376） Histone H2A × 2 （A0A6A5Q1K4） Histone H2B × 2 （A0A6A5PZQ7） Histone H3 × 2 （P02299） Histone H4 × 2 （A0A0B4KFZ9） DNA (214-MER) × 1 DNA (214-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RUVB2_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–471； UniProt 1–471 Author chain H； PDBConstruct 1–471； UniProt 1–471 Author chain J； PDBConstruct 1–471； UniProt 1–471

SWR1-complex protein 3

OrganismNot specified

UniProt P31376

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	Helicase SWR1 × 1 Vacuolar protein sorting-associated protein 72 × 1 （Q03388） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 RuvB-like protein 2 × 3 （Q12464） Histone H2A × 2 （A0A6A5Q1K4） Histone H2B × 2 （A0A6A5PZQ7） Histone H3 × 2 （P02299） Histone H4 × 2 （A0A0B4KFZ9） DNA (214-MER) × 1 DNA (214-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SWC3_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain K； PDBConstruct 1–625； UniProt 1–625

Histone H2A

Saccharomyces cerevisiae

UniProt A0A6A5Q1K4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	Helicase SWR1 × 1 Vacuolar protein sorting-associated protein 72 × 1 （Q03388） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 RuvB-like protein 2 × 3 （Q12464） SWR1-complex protein 3 × 1 （P31376） Histone H2B × 2 （A0A6A5PZQ7） Histone H3 × 2 （P02299） Histone H4 × 2 （A0A0B4KFZ9） DNA (214-MER) × 1 DNA (214-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5Q1K4_YEASX
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Q； PDBConstruct 1–132； UniProt 1–132 Author chain S； PDBConstruct 1–132； UniProt 1–132

Histone H2B

Saccharomyces cerevisiae

UniProt A0A6A5PZQ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	Helicase SWR1 × 1 Vacuolar protein sorting-associated protein 72 × 1 （Q03388） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 RuvB-like protein 2 × 3 （Q12464） SWR1-complex protein 3 × 1 （P31376） Histone H2A × 2 （A0A6A5Q1K4） Histone H3 × 2 （P02299） Histone H4 × 2 （A0A0B4KFZ9） DNA (214-MER) × 1 DNA (214-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PZQ7_YEASX
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain R； PDBConstruct 1–131； UniProt 1–131 Author chain T； PDBConstruct 1–131； UniProt 1–131

Histone H3

Drosophila melanogaster

UniProt P02299

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	Helicase SWR1 × 1 Vacuolar protein sorting-associated protein 72 × 1 （Q03388） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 RuvB-like protein 2 × 3 （Q12464） SWR1-complex protein 3 × 1 （P31376） Histone H2A × 2 （A0A6A5Q1K4） Histone H2B × 2 （A0A6A5PZQ7） Histone H4 × 2 （A0A0B4KFZ9） DNA (214-MER) × 1 DNA (214-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H3_DROME
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain U； PDBConstruct 1–136； UniProt 1–136 Author chain W； PDBConstruct 1–136； UniProt 1–136

Histone H4

Drosophila melanogaster

UniProt A0A0B4KFZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 19 DNA 2	Helicase SWR1 × 1 Vacuolar protein sorting-associated protein 72 × 1 （Q03388） Actin-like protein ARP6 × 1 （Q12509） Vacuolar protein sorting-associated protein 71 × 1 （Q03433） RuvB-like protein 1 × 3 RuvB-like protein 2 × 3 （Q12464） SWR1-complex protein 3 × 1 （P31376） Histone H2A × 2 （A0A6A5Q1K4） Histone H2B × 2 （A0A6A5PZQ7） Histone H3 × 2 （P02299） DNA (214-MER) × 1 DNA (214-MER) × 1 ADENOSINE-5'-DIPHOSPHATE × 8 BERYLLIUM TRIFLUORIDE ION × 2 MAGNESIUM ION × 8 ZINC ION × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0B4KFZ9_DROME
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain V； PDBConstruct 1–103； UniProt 1–103 Author chain X； PDBConstruct 1–103； UniProt 1–103

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9b1e
Deposition date deposition_date	2024-03-13
Structure title title	Cryo-EM structure of native SWR1 bound to nucleosome (composite structure)
Keywords keywords	Chromatin Remodeler, Snf2 family ATPase, histone exchange, H2A.Z, GENE REGULATION; GENE REGULATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9b1e__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9b1e__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9b1e__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	66.91 Å
Rg (electron density)	65.66 Å
Total Rg	65.93 Å
Atom count	49842
Residues	5695
Excluded volume	867280 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9b1e__assembly_1__model_1`	21-meric （21）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	Helicase SWR1
Molecular weight formula_weight	178058.2 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	49842

MTTSRKSHAKDKKAGGEQDLADLKFRYDLLTNELFHLREFVSLVDYDPTHFNDSESFQKFLRETHLSLEERGEKFTDDVAKKGTNGDLTRRRRNLRTSTVVSSETTNEKKGDIELKLESIAPLVRNKCEELKYKLSDHSNRKSIVPQKRPIQHLKKREAAKSLKFKSERKENPLPLHEHIAEERYDHIAKVEEPSEAFTIKCPSDDSSFENTSEHYSDNFYFTTSSEEEDIKKKRGRKKKKPRIKLVVHPPKQTITNPLHVVKPGYESLHEYIASFKSLEDDLTLEEYNKYIDEQRRLLSRLKKGIENGALKYDKETDSLQPITSKEIKTIITYKPDPISYFYKQQDLQIHTDHLINQGIHMSKLFRSSTKARIARAKKVSQMIEQHFKHVAGAEERKAKEEERHKKSLARFAVQAVKKRWNMAEKAYRILRKDEEEQLKRIEGKQHLSKMLEKSTQLLEAQLNQVNDDGRSSTPSSDSNDVLSESDDDMDDELSTSSDEDEEVDADVGLENSPASTEATPTDESLNLIQLKEKYGHFNGSSTVYDSRNKDEKFPTLDKHESSSSESSVMTGEESSIYSSSENESQNENDRESDDKTPSVGLSALFGKGEESDGDLDLDDSEDFTVNSSSVEGEELEKDQVDNSAATFERAGDFVHTQNENRDDIKDVEEDAETKVQEEQLSVVDVPVPSLLRGNLRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKENWGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNKPDAFHVCIVSYQLVVQDQHSFKRKRWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVAKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPNLFEVRPILTSFVLEHCVASDYKDVERTLLKLFKKNNQVNRVDLDFLNLVFTLNDKDLTSYHAEEISKLTCVKNFVEEVNKLRETNKQLQEEFGEASFLNFQDANQYFKYSNKQKLEGTVDMLNFLKMVNKLRCDRRPIFGKNLIDLLTKDRRVKYDKSSIIDNELIKPLQTRVLDNRKIIDTFAVLTPSAVSLDMRKLALGLNDDSSVGENTRLKVMQNCFEVSNPLHQLQTKLTIAFPDKSLLQYDCGKLQKLAILLQQLKDNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNTDSRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDNVVIQEGDFTTDYFSKLSVRDLLGSELPENASGGDKPLIADADVAAKDPRQLERLLAQAEDEDDVKAANLAMREVEIDNDDFDESTEKKAANEEEENHAELDEYEGTAHVDEYMIRFIANGYYYGSGGSGDYKDHDGDYKDHDIDYKDDDDKGS

Entity 2 Entity 2 polymer

Description description	Vacuolar protein sorting-associated protein 72
Molecular weight formula_weight	90709.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSDEGADKSLDTNTEFIIQTRSRRSNAGNKLQKLLEQELRDIESTKRQISSYKNGNDDEEDEIGLLFQEDEDDEDFEMMAKDDDDEGEEKEDETQSIRKEPSQASSEQAADDLMFSSSESEDSSNENDEDAEEKEIRRQELLSRKKRNKRLQKGPVVIKKQKPKPKSGEAIPRSHHTHEQLNAETLLLNTRRTSKRSSVMENTMKVYEKLSKAEKKRKIIQERIRKHKEQESQHMLTQEERLRIAKETEKLNILSLDKFKEQEVWKKENRLALQKRQKQKFQPNETILQFLSTAWLMTPAMELEDRKYWQEQLNKRDKKKKKYPRKPKKNLNLGKQDASDDKKRESEESIKNDGDVNSLGENSSSVHNQKRIEETSTNDTVEGESSPDAAVSRVNSDELKPTALPDVTLDAIANKQSTVDEAPNSQPQKNIITNEQKITNVGEPIQNLHNEEIKDEMVSALESRENTFENSSPAAQVVSQRDNSATPTPSNSTGTEDTILISPDTDIKGEPEPCLKTEGIENLSHNVPQETKSNTDVSFLKQVTFTDHPQVAIIDTEESPSKKDTANVDESSAENSLSTQTYEGPEQLTSRNFVTLYDFPNAPPNLKDFNTNLFGDRWSYTNGLSATQRPQDMKTVFHSILPSPPQSSVPSPTVDISLDLSALANFPSFGEYDKKIVHQINTEINKDLEIKIKTQPPTGVFLANGIRKKCLITNKECQYFDPRTGVPYSDVEAYKIIQRIQDPISKEEGRSDIKRDETTNEDSDDQVRFKWFGFKNGGIYLDLSQRPAKGVPEGF

Entity 3 Entity 3 polymer

Description description	Actin-like protein ARP6
Molecular weight formula_weight	50100.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRFGYQNWI

Entity 4 Entity 4 polymer

Description description	Vacuolar protein sorting-associated protein 71
Molecular weight formula_weight	32073.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MKALVEEIDKKTYNPDIYFTSLDPQARRYTSKKINKQGTISTSRPVKRINYSLADLEARLYTSRSEGDGNSISRQDDRNSKNSHSFEERYTQQEILQSDRRFMELNTENFSDLPNVPTLLSDLTGVPRDRIESTTKPISQTSDGLSALMGGSSFVKEHSKYGHGWVLKPETLREIQLSYKSTKLPKPKRKNTNRIVALKKVLSSKRNLHSFLDSALLNLMDKNVIYHNVYNKRYFKVLPLITTCSICGGYDSISSCVNCGNKICSVSCFKLHNETRCRNR

Entity 5 Entity 5 polymer

Description description	RuvB-like protein 1
Molecular weight formula_weight	91413.2 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G,I

MVAISEVKENPGVNSSNSGAVTRTAAHTHIKGLGLDESGVAKRVEGGFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDLETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDAKRSTKILETSANYLSGGGASMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTN

Entity 6 Entity 6 polymer

Description description	RuvB-like protein 2
Molecular weight formula_weight	51673.5 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,H,J

MSIQTSDPNETSDLKSLSLIAAHSHITGLGLDENLQPRPTSEGMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLGKDVPFTAIAGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGTNYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDSARSVKYVQENESQYIDDQGNVQISIAKSADPDAMDTTE

Entity 7 Entity 7 polymer

Description description	SWR1-complex protein 3
Molecular weight formula_weight	72648.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MPAVLRTRSKESSIEQKPASRTRTRSRRGKRGRDDDDDDDDEESDDAYDEVGNDYDEYASRAKLATNRPFEIVAGLPASVELPNYNSSLTHPQSIKNSGVLYDSLVSSRRTWVQGEMFELYWRRPKKIVSESTPAATESPTSGTIPLIRDKMQKMCDCVMSGGPHTFKVRLFILKNDKIEQKWQDEQELKKKEKELKRKNDAEAKRLRMEERKRQQMQKKIAKEQKLQLQKENKAKQKLEQEALKLKRKEEMKKLKEQNKNKQGSPSSSMHDPRMIMNLNLMAQEDPKLNTLMETVAKGLANNSQLEEFKKFIEIAKKRSLEENPVNKRPSVTTTRPAPPSKAKDVAEDHRLNSITLVKSSKTAATEPEPKKADDENAEKQQSKEAKTTAESTQVDVKKEEEDVKEKGVKSEDTQKKEDNQVVPKRKRRKNAIKEDKDMQLTAFQQKYVQGAEIILEYLEFTHSRYYLPKKSVVEFLEDTDEIIISWIVIHNSKEIEKFKTKKIKAKLKADQKLNKEDAKPGSDVEKEVSFNPLFEADCPTPLYTPMTMKLSGIHKRFNQIIRNSVSPMEEVVKEMEKILQIGTRLSGYNLWYQLDGYDDEALSESLRFELNEWEHAMRSRRHKR

Entity 8 Entity 8 polymer

Description description	Histone H2A
Molecular weight formula_weight	14013.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,S

MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATKASQEL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21

Entity 9 Entity 9 polymer

Description description	Histone H2B
Molecular weight formula_weight	14280.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,T

MSAKAEKKPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQA

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli BL21

Entity 10 Entity 10 polymer

Description description	Histone H3
Molecular weight formula_weight	15421.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,W

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli BL21

Entity 11 Entity 11 polymer

Description description	Histone H4
Molecular weight formula_weight	11408.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,X

MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	Escherichia coli BL21

Entity 12 Entity 12 polymer

Description description	DNA (214-MER)
Molecular weight formula_weight	65672.8 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Y

ATCGCATCGATCTTCACACCGAGTTCATCCCTTATGTGATGGACCCTATACGCGGCCGCCCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGCAAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGCATGAT

Entity 13 Entity 13 polymer

Description description	DNA (214-MER)
Molecular weight formula_weight	66478.3 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	Z

ATCATGCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTTGCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAGGGCGGCCGCGTATAGGGTCCATCACATAAGGGATGAACTCGGTGTGAAGATCGATGCGAT

Entity 14 Entity 14 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 15 Entity 15 non-polymer

Description description	BERYLLIUM TRIFLUORIDE ION
Molecular weight formula_weight	66.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 16 Entity 16 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 17 Entity 17 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	16524

Cryo-EM structure of native SWR1 bound to nucleosome (composite structure)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vacuolar protein sorting-associated protein 72

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-like protein ARP6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Vacuolar protein sorting-associated protein 71

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RuvB-like protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SWR1-complex protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H2B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Histone H4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9b1e__assembly_1__model_1

9b1e__assembly_1__model_1 | I(q)

9b1e__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment