9b85

Cryo-EM structure of human dynactin complex bound to Chlamydia effector Dre1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Alpha-centractin

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Actin, cytoplasmic 1 × 1 （P60709） Actin-related protein 10 × 1 （Q9NZ32） Dynactin subunit 4 × 1 （Q9UJW0） Dynactin subunit 5 × 1 （Q9BTE1） Dynactin subunit 6 × 1 （O00399） F-actin-capping protein subunit alpha-1 × 1 （P52907） F-actin-capping protein subunit beta × 1 （P47756） Dynactin subunit 2 × 4 （Q13561） ADENOSINE-5'-DIPHOSPHATE × 8 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTZ_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–376； UniProt 1–376 Author chain B； PDBConstruct 1–376； UniProt 1–376 Author chain C； PDBConstruct 1–376； UniProt 1–376 Author chain D； PDBConstruct 1–376； UniProt 1–376 Author chain E； PDBConstruct 1–376； UniProt 1–376 Author chain F； PDBConstruct 1–376； UniProt 1–376 Author chain G； PDBConstruct 1–376； UniProt 1–376 Author chain I； PDBConstruct 1–376； UniProt 1–376

Actin, cytoplasmic 1

OrganismNot specified

UniProt P60709

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Alpha-centractin × 8 （P61163） Actin-related protein 10 × 1 （Q9NZ32） Dynactin subunit 4 × 1 （Q9UJW0） Dynactin subunit 5 × 1 （Q9BTE1） Dynactin subunit 6 × 1 （O00399） F-actin-capping protein subunit alpha-1 × 1 （P52907） F-actin-capping protein subunit beta × 1 （P47756） Dynactin subunit 2 × 4 （Q13561） ADENOSINE-5'-DIPHOSPHATE × 8 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTB_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–375； UniProt 1–375

Actin-related protein 10

OrganismNot specified

UniProt Q9NZ32

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Alpha-centractin × 8 （P61163） Actin, cytoplasmic 1 × 1 （P60709） Dynactin subunit 4 × 1 （Q9UJW0） Dynactin subunit 5 × 1 （Q9BTE1） Dynactin subunit 6 × 1 （O00399） F-actin-capping protein subunit alpha-1 × 1 （P52907） F-actin-capping protein subunit beta × 1 （P47756） Dynactin subunit 2 × 4 （Q13561） ADENOSINE-5'-DIPHOSPHATE × 8 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ARP10_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–417； UniProt 1–417

Dynactin subunit 4

OrganismNot specified

UniProt Q9UJW0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Alpha-centractin × 8 （P61163） Actin, cytoplasmic 1 × 1 （P60709） Actin-related protein 10 × 1 （Q9NZ32） Dynactin subunit 5 × 1 （Q9BTE1） Dynactin subunit 6 × 1 （O00399） F-actin-capping protein subunit alpha-1 × 1 （P52907） F-actin-capping protein subunit beta × 1 （P47756） Dynactin subunit 2 × 4 （Q13561） ADENOSINE-5'-DIPHOSPHATE × 8 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN4_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–460； UniProt 1–460

Dynactin subunit 5

OrganismNot specified

UniProt Q9BTE1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Alpha-centractin × 8 （P61163） Actin, cytoplasmic 1 × 1 （P60709） Actin-related protein 10 × 1 （Q9NZ32） Dynactin subunit 4 × 1 （Q9UJW0） Dynactin subunit 6 × 1 （O00399） F-actin-capping protein subunit alpha-1 × 1 （P52907） F-actin-capping protein subunit beta × 1 （P47756） Dynactin subunit 2 × 4 （Q13561） ADENOSINE-5'-DIPHOSPHATE × 8 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN5_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–182； UniProt 1–182

Dynactin subunit 6

OrganismNot specified

UniProt O00399

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Alpha-centractin × 8 （P61163） Actin, cytoplasmic 1 × 1 （P60709） Actin-related protein 10 × 1 （Q9NZ32） Dynactin subunit 4 × 1 （Q9UJW0） Dynactin subunit 5 × 1 （Q9BTE1） F-actin-capping protein subunit alpha-1 × 1 （P52907） F-actin-capping protein subunit beta × 1 （P47756） Dynactin subunit 2 × 4 （Q13561） ADENOSINE-5'-DIPHOSPHATE × 8 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN6_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–190； UniProt 1–190

F-actin-capping protein subunit alpha-1

OrganismNot specified

UniProt P52907

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Alpha-centractin × 8 （P61163） Actin, cytoplasmic 1 × 1 （P60709） Actin-related protein 10 × 1 （Q9NZ32） Dynactin subunit 4 × 1 （Q9UJW0） Dynactin subunit 5 × 1 （Q9BTE1） Dynactin subunit 6 × 1 （O00399） F-actin-capping protein subunit beta × 1 （P47756） Dynactin subunit 2 × 4 （Q13561） ADENOSINE-5'-DIPHOSPHATE × 8 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAZA1_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain N； PDBConstruct 1–286； UniProt 1–286

F-actin-capping protein subunit beta

OrganismNot specified

UniProt P47756

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Alpha-centractin × 8 （P61163） Actin, cytoplasmic 1 × 1 （P60709） Actin-related protein 10 × 1 （Q9NZ32） Dynactin subunit 4 × 1 （Q9UJW0） Dynactin subunit 5 × 1 （Q9BTE1） Dynactin subunit 6 × 1 （O00399） F-actin-capping protein subunit alpha-1 × 1 （P52907） Dynactin subunit 2 × 4 （Q13561） ADENOSINE-5'-DIPHOSPHATE × 8 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPZB_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain O； PDBConstruct 1–272； UniProt 1–272

Dynactin subunit 2

OrganismNot specified

UniProt Q13561

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Alpha-centractin × 8 （P61163） Actin, cytoplasmic 1 × 1 （P60709） Actin-related protein 10 × 1 （Q9NZ32） Dynactin subunit 4 × 1 （Q9UJW0） Dynactin subunit 5 × 1 （Q9BTE1） Dynactin subunit 6 × 1 （O00399） F-actin-capping protein subunit alpha-1 × 1 （P52907） F-actin-capping protein subunit beta × 1 （P47756） ADENOSINE-5'-DIPHOSPHATE × 8 PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DCTN2_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain P； PDBConstruct 1–401； UniProt 1–401 Author chain Q； PDBConstruct 1–401； UniProt 1–401 Author chain p； PDBConstruct 1–401； UniProt 1–401 Author chain q； PDBConstruct 1–401； UniProt 1–401

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9b85
Deposition date deposition_date	2024-03-28
Last revision last_revision	2025-04-16
Structure title title	Cryo-EM structure of human dynactin complex bound to Chlamydia effector Dre1
Keywords keywords	Human dynactin, Chlamydia effector, host-pathogen interaction, MOTOR PROTEIN; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9b85__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9b85__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9b85__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	107.30 Å
Total Rg	107.00 Å
Atom count	82296
Residues	5159
Excluded volume	735140 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9b85__assembly_1__model_1`	19-meric （19）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (12)

Entity 1 Entity 1 polymer

Description description	Alpha-centractin
Molecular weight formula_weight	42670.7 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,I
Atom count atom_count	82296

MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF

Entity 2 Entity 2 polymer

Description description	Actin, cytoplasmic 1
Molecular weight formula_weight	41782.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Entity 3 Entity 3 polymer

Description description	Actin-related protein 10
Molecular weight formula_weight	46360.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MPLYEGLGSGGEKTAVVIDLGEAFTKCGFAGETGPRCIIPSVIKRAGMPKPVRVVQYNINTEELYSYLKEFIHILYFRHLLVNPRDRRVVIIESVLCPSHFRETLTRVLFKYFEVPSVLLAPSHLMALLTLGINSAMVLDCGYRESLVLPIYEGIPVLNCWGALPLGGKALHKELETQLLEQCTVDTSVAKEQSLPSVMGSVPEGVLEDIKARTCFVSDLKRGLKIQAAKFNIDGNNERPSPPPNVDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK

Entity 4 Entity 4 polymer

Description description	Dynactin subunit 4
Molecular weight formula_weight	52409.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MASLLQSDRVLYLVQGEKKVRAPLSQLYFCRYCSELRSLECVSHEVDSHYCPSCLENMPSAEAKLKKNRCANCFDCPGCMHTLSTRATSISTQLPDDPAKTTMKKAYYLACGFCRWTSRDVGMADKSVASGGWQEPENPHTQRMNKLIEYYQQLAQKEKVERDRKKLARRRNYMPLAFSDKYGLGTRLQRPRAGASISTLAGLSLKEGEDQKEIKIEPAQAVDEVEPLPEDYYTRPVNLTEVTTLQQRLLQPDFQPVCASQLYPRHKHLLIKRSLRCRKCEHNLSKPEFNPTSIKFKIQLVAVNYIPEVRIMSIPNLRYMKESQVLLTLTNPVENLTHVTLFECEEGDPDDINSTAKVVVPPKELVLAGKDAAAEYDELAEPQDFQDDPDIIAFRKANKVGIFIKVTPQREEGEVTVCFKMKHDFKNLAAPIRPIEESDQGTEVIWLTQHVELSLGPLLP

Entity 5 Entity 5 polymer

Description description	Dynactin subunit 5
Molecular weight formula_weight	20150.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV

Entity 6 Entity 6 polymer

Description description	Dynactin subunit 6
Molecular weight formula_weight	20769.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

Entity 7 Entity 7 polymer

Description description	F-actin-capping protein subunit alpha-1
Molecular weight formula_weight	32964.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Entity 8 Entity 8 polymer

Description description	F-actin-capping protein subunit beta
Molecular weight formula_weight	30669.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Entity 9 Entity 9 polymer

Description description	Dynactin subunit 2
Molecular weight formula_weight	44285.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Q,p,q

MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKTTVKESATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELETAVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGK

Entity 10 Entity 10 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 11 Entity 11 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	506.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 12 Entity 12 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Resolution resolution	3.47 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	50376

Cryo-EM structure of human dynactin complex bound to Chlamydia effector Dre1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Alpha-centractin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin, cytoplasmic 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Actin-related protein 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin-capping protein subunit alpha-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-actin-capping protein subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Dynactin subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9b85__assembly_1__model_1

9b85__assembly_1__model_1 | I(q)

9b85__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment