SAXSdb — 9euj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate protein

Staphylococcus phage 812

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Major tail sheath protein × 36 （A0A0U1WZ79） Baseplate wedge subunit × 6 （A0A0U1UXD7） Baseplate component × 12 （A0A0U1WF63） TmpF × 6 （A0A0U1WGD3） DUF4815 domain-containing protein × 18 （A0A8E5NSA0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WGQ5_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain H； PDBConstruct 1–173； UniProt 1–173

Major tail sheath protein

OrganismNot specified

UniProt A0A0U1WZ79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Baseplate protein × 6 （A0A0U1WGQ5） Baseplate wedge subunit × 6 （A0A0U1UXD7） Baseplate component × 12 （A0A0U1WF63） TmpF × 6 （A0A0U1WGD3） DUF4815 domain-containing protein × 18 （A0A8E5NSA0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WZ79_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 1–587； UniProt 1–587 Author chain J； PDBConstruct 1–587； UniProt 1–587 Author chain K； PDBConstruct 1–587； UniProt 1–587 Author chain L； PDBConstruct 1–587； UniProt 1–587 Author chain M； PDBConstruct 1–587； UniProt 1–587 Author chain N； PDBConstruct 1–587； UniProt 1–587

Baseplate wedge subunit

OrganismNot specified

UniProt A0A0U1UXD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Baseplate protein × 6 （A0A0U1WGQ5） Major tail sheath protein × 36 （A0A0U1WZ79） Baseplate component × 12 （A0A0U1WF63） TmpF × 6 （A0A0U1WGD3） DUF4815 domain-containing protein × 18 （A0A8E5NSA0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1UXD7_9CAUD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–234； UniProt 1–234

Baseplate component

OrganismNot specified

UniProt A0A0U1WF63

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Baseplate protein × 6 （A0A0U1WGQ5） Major tail sheath protein × 36 （A0A0U1WZ79） Baseplate wedge subunit × 6 （A0A0U1UXD7） TmpF × 6 （A0A0U1WGD3） DUF4815 domain-containing protein × 18 （A0A8E5NSA0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WF63_9CAUD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain B； PDBConstruct 1–348； UniProt 1–348 Author chain C； PDBConstruct 1–348； UniProt 1–348

TmpF

OrganismNot specified

UniProt A0A0U1WGD3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Baseplate protein × 6 （A0A0U1WGQ5） Major tail sheath protein × 36 （A0A0U1WZ79） Baseplate wedge subunit × 6 （A0A0U1UXD7） Baseplate component × 12 （A0A0U1WF63） DUF4815 domain-containing protein × 18 （A0A8E5NSA0）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1WGD3_9CAUD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 1–1019； UniProt 1–1019

DUF4815 domain-containing protein

OrganismNot specified

UniProt A0A8E5NSA0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 84	Baseplate protein × 6 （A0A0U1WGQ5） Major tail sheath protein × 36 （A0A0U1WZ79） Baseplate wedge subunit × 6 （A0A0U1UXD7） Baseplate component × 12 （A0A0U1WF63） TmpF × 6 （A0A0U1WGD3）	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8E5NSA0_9CAUD
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain E； PDBConstruct 1–1152； UniProt 1–1152 Author chain F； PDBConstruct 1–1152； UniProt 1–1152 Author chain G； PDBConstruct 1–1152； UniProt 1–1152

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9euj
Deposition date deposition_date	2024-03-27
Structure title title	Cryo-EM structure of Staphylococcus aureus bacteriophage phi812 baseplate in the post-contraction state - sheath initiator, wedge module, inner tripod, arm segment, and proximal tail sheath proteins
Keywords keywords	bacteriophage, phage, contractile, phi812, baseplate, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9euj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9euj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9euj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	155.20 Å
Total Rg	155.10 Å
Atom count	341388
Residues	43392
Excluded volume	6052300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9euj__assembly_1__model_1`	14-meric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Baseplate protein
Molecular weight formula_weight	21588.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H
Atom count atom_count	56898

MAIATYNSHVELAKYLVSKADSVYLTIGKSTPWSNETNPPQPDENATVLQEVIGYKKATKVTLVRPSKSPEDDNKNLISYGNKSWVEVTPENAKAEGAKWVYLESSIVGDELPLGTYRQVGFVMDLVAKSGISKFNLVPSEVESTGTLLFFDNKQFQNRSEQTTAKERFIVEVDPNSSSVDKLAAALEHHHHHH

Source Source

Source organism organism	Staphylococcus phage 812
NCBI taxonomy ID ncbi_taxonomy_id	307898
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Major tail sheath protein
Molecular weight formula_weight	64559.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,L,M,N

MAVEPFPRRPITRPHASIEVDTSGIGGSAGSSEKVFCLIGQAEGGEPNTVYELRNYSQAKRLFRSGELLDAIELAWGSNPNYTAGRILAMRIEDAKPASAEIGGLKITSKIYGNVANNIQVGLEKNTLSDSLRLRVIFQDDRFNEVYDNIGNIFTIKYKGEEANATFSVEHDEETQKASRLVLKVGDQEVKSYDLTGGAYDYTNAIITDINQLPDFEAKLSPFGDKNLESSKLDKIENANIKDKAVYVKAVFGDLEKQTAYNGIVSFEQLNAEGEVPSNVEVEAGEESATVTATSPIKTIEPFELTKLKGGTNGEPPATWADKLDKFAHEGGYYIVPLSSKQSVHAEVASFVKERSDAGEPMRAIVGGGFNESKEQLFGRQASLSNPRVSLVANSGTFVMDDGRKNHVPAYMVAVALGGLASGLEIGESITFKPLRVSSLDQIYESIDLDELNENGIISIEFVRNRTNTFFRIVDDVTTFNDKSDPVKAEMAVGEANDFLVSELKVQLEDQFIGTRTINTSASIIKDFIQSYLGRKKRDNEIQDFPAEDVQVIVEGNEARISMTVYPIRSFKKISVSLVYKQQTLQA

Entity 3 Entity 3 polymer

Description description	Baseplate wedge subunit
Molecular weight formula_weight	26611.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MRFKKHVVQHEETMQAIAQRYYGDVSYWIDLVEHNNLKYPYLVETDEEKMKDPERLASTGDTLIIPIESDLTDVSAKEINSRDKDVLVELALGRDLNITADEKYFNEHGTSDNILAFSTNGNGDLDTVKGIDNMKQQLQARLLTPRGSLMLHPNYGSDLHNLFGLNIPEQATLIEMEVLRTLTSDNRVKSANLIDWKIQGNVYSGQFSVEIKSVEESINFVLGQDEEGIFALFE

Entity 4 Entity 4 polymer

Description description	Baseplate component
Molecular weight formula_weight	39248.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

MKTRKLTNILSKLIDKTMAGTSKITDFTPGSASRSLLEAVSLEIEQFYILTKENIDWGIQEGIIEAFDFQKRQSKRAYGDVTIQFYQPLDMRMYIPAGTTFTSTRQEYPQQFETLVDYYAEPDSTEIVVEVYCKETGVAGNVPEGTINTIASGSSLIRSVNNEYSFNTGTKEESQEDFKRRFHSFVESRGRATNKSVRYGALQIPDVEGVYVYEETGHITVFAHDRNGNLSDTLKEDIIDALQDYRPSGIMLDVTGVEKEEVNVSATVTISNKSRIGDTLQKHIESVIRSYLNNLKTSDDLIITDLIQAIMNIDDVLIYDVSFDNLDENIIVPPQGIIRAGEIKVELK

Entity 5 Entity 5 polymer

Description description	TmpF
Molecular weight formula_weight	116389.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MANFLKNLHPLLRRDRNKKDNQDPNFALIDALNEEMNQVEKDAIESKLQSSLKTSTSEYLDKFGDWFGVYRKTDEKDDVYRARIIKYLLLKRGTNNAIIDAIKDYLGRDDIDVSVYEPFTNIFYTNKSHLNGEDHLMGYYYRFAVINVSIGDYFPVEIIDVINEFKPAGVTLYVTYDGASTIRGGAIIKWLDGLPKIETYQEFDRFTGYDDTFYGHINMNQSKDTDNSSSDIFKTNHSLINSLDVLTGSSSVGRQYINYGYVTSYVYNPGMTSSVNQISASTEGRGQEVPTDYYMYTSTKNNNTVELSMQTTSGVSYLYNNFNFRDYMSKYRPQVDLQSDEARRIVSDYIKELSIDYYLSAVIPPDESIEIKLQVYDFSINRWLTVSINNLSFYEKNIGSNIGYIKDYLNSELNMFTRLEINAGKRDSVDIKVNYLDLMFYYYERGIYTIKPYKALIENYLDISRETYVEAFKIASLSNGDIITKTGFQPIGYLKLVGNYENTIPSTINIVAKDTDNNPIESNELDVYNTVENRNLLQSYKGVNTIAREITSTKEFTVSGWAKEIYSTNYLSKVLKPGKVYTLSFDMEITGNDPTLKSYSDNHGIYLYSNTKGIVVNGVKSMERTIGNKVSVTQTFTAPTITDHRLLIYTGRYTSDGKASTPPVFFNTVKITELKLTEGSSKLEYSPAPEDKPNVIEKGIKFNNILTNIQTLSINSDTILKNVTLYYSYYGDSWVELKTLGNISTGETTETNNLIDLYGLQTVDYSNINPMSKVSLRSIWNVKLGELNNQEGSLSNMPNDYFNAVWQDIDKLSDIELGSMRMVKDTEGGVFDGATGEIIKATLFNVGAYTDLDMLAYTLTNYTEPLTLGSSRLISELKEELLTSESFNVDNRIKVIDSIYEELPNTSIIKNGFVEREVTGSKYLDYGLYEPIEDGTRYKLIVEGEFKDNIEFISLYNSNPNFNETFIYPSEIINGVAEKEFIAKPSTEDKPRLNTDVRIYIRPYDSTISKVRRVELRKV

Entity 6 Entity 6 polymer

Description description	DUF4815 domain-containing protein
Molecular weight formula_weight	129263.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G

MAINFKGSPYLDRFDPSKDRTKVLFNPDRPLQQAELNEMQSIDQYYLKNLGDAIFKDGDKQSGLGFTLSEDNVLTVNPGYVYINGKIRYYDNDDSVKITGVGKETIGIKLTERIVTPDEDASLLDQTSGVPSYFSKGADRLEEKMSLTVNDPTSATIYTFMDGDLYIQSTNAEMDKINKVLAERTYDESGSYKVNGFELFSEGNAEDDDHVSVVVDAGKAYVKGFKVDKPVSTRISVPKSYDLGTAENESTIFNKSNNSISLANSPVKEIRRVTGQVLIEKERVTRGAQGDGQDFLSNNTAFEIVKVWTETSPGVTTKEYKQGEDFRLTDGQTIDWSPQGQEPSGGTSYYVSYKYNKRMEAGKDYEVTTQGEGLSKKWYINFTPSNGAKPIDQTVVLVDYTYYLARKDSVFINKYGDIAILPGEPNIMRLVTPPLNTDPENLQLGTVTVLPDSDEAVCISFAITRLSMEDLQKVKTRVDNLEYNQAVNALDDGAMEGQNPLTLRSVFSEGFISLDKADITHPDFGIVFSFEDAEATLAYTEAVNQPKIIPGDTTAHIWGRLISAPFTEERTIYQGQASETLNVNPYNIPNKQGVLKLTPSEDNWIDTENVTITEQKTKKVTMKRFWRHNESYYGETEHYLYSNLQLDAGQKWKGETYAYDREHGRTGTLLESGGQRTLEEMIEFIRIRDVSFEVKGLNPNDNNLYLLFDGVRCAITPATGYRKGSEDGTIMTDAKGTAKGKFTIPAGIRCGNREVTLKNANSTSATTYTAQGRKKTAQDIIIRTRVTVNLVDPLAQSFQYDENRTISSLGLYFASKGDKQSNVVIQIRGMGDQGYPNKTIYAETVMNADDIKVSNNASAETRVYFDDPMMAEGGKEYAIVIITENSDYTMWVGTRTKPKIDKPNEVISGNPYLQGVLFSSSNASTWTPHQNSDLKFGIYTSKFNETATIEFEPIKDVSADRIVLMSTYLTPERTGCTWEMKLILDDMASSTTFDQLKWEPIGNYQDLDVLGLARQVKLRATFESNRYISPLMSSSDLTFTTFLTELTGSYVGRAIDMTEAPYNTVRFSYEAFLPKGTKVVPKYSADDGKTWKTFTKSPTTTRANNEFTRYVIDEKVKSSGTNTKLQVRLDLSTENSFLRPRVRRLMVTTRDE

▶

Resolution resolution	4.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	25203

Cryo-EM structure of Staphylococcus aureus bacteriophage phi812 baseplate in the post-contraction state - sheath initiator, wedge module, inner tripod, arm segment, and proximal tail sheath proteins

1. Protein Identity and Related Structures Protein Identity & Related Structures

Baseplate protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Major tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate wedge subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Baseplate component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TmpF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DUF4815 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9euj__assembly_1__model_1

9euj__assembly_1__model_1 | I(q)

9euj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

7. Citations (1)