9g8n

80S-bound human Ski2-exosome complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Exosome complex component RRP41

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component RRP40 × 1 （Q9NQT5） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component MTR3 × 1 （Q5RKV6） Exosome complex component RRP4 × 1 （Q13868） Isoform 2 of HBS1-like protein × 1 （Q9Y450） Exosome complex component RRP45 × 1 （Q06265） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXOS4_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain L； PDBConstruct 1–245； UniProt 1–245

Exosome complex component RRP43

Homo sapiens

UniProt Q96B26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component RRP40 × 1 （Q9NQT5） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component MTR3 × 1 （Q5RKV6） Exosome complex component RRP4 × 1 （Q13868） Isoform 2 of HBS1-like protein × 1 （Q9Y450） Exosome complex component RRP45 × 1 （Q06265） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXOS8_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain N； PDBConstruct 5–280； UniProt 1–276

Exosome complex component RRP46

Homo sapiens

UniProt Q9NQT4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component RRP40 × 1 （Q9NQT5） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component MTR3 × 1 （Q5RKV6） Exosome complex component RRP4 × 1 （Q13868） Isoform 2 of HBS1-like protein × 1 （Q9Y450） Exosome complex component RRP45 × 1 （Q06265） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXOS5_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain O； PDBConstruct 5–239； UniProt 1–235

Exosome complex component RRP42

Homo sapiens

UniProt Q15024

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP40 × 1 （Q9NQT5） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component MTR3 × 1 （Q5RKV6） Exosome complex component RRP4 × 1 （Q13868） Isoform 2 of HBS1-like protein × 1 （Q9Y450） Exosome complex component RRP45 × 1 （Q06265） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXOS7_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 5–295； UniProt 1–291

Exosome complex component RRP40

Homo sapiens

UniProt Q9NQT5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component MTR3 × 1 （Q5RKV6） Exosome complex component RRP4 × 1 （Q13868） Isoform 2 of HBS1-like protein × 1 （Q9Y450） Exosome complex component RRP45 × 1 （Q06265） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXOS3_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain H； PDBConstruct 5–279； UniProt 1–275

Exosome complex component CSL4

Homo sapiens

UniProt Q9Y3B2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component RRP40 × 1 （Q9NQT5） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component MTR3 × 1 （Q5RKV6） Exosome complex component RRP4 × 1 （Q13868） Isoform 2 of HBS1-like protein × 1 （Q9Y450） Exosome complex component RRP45 × 1 （Q06265） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXOS1_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain J； PDBConstruct 5–199； UniProt 1–195

Helicase SKI2W

Homo sapiens

UniProt Q15477

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component RRP40 × 1 （Q9NQT5） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Exosome complex component MTR3 × 1 （Q5RKV6） Exosome complex component RRP4 × 1 （Q13868） Isoform 2 of HBS1-like protein × 1 （Q9Y450） Exosome complex component RRP45 × 1 （Q06265） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SKIV2_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A； PDBConstruct 1–1246； UniProt 1–1246

Exosome complex component MTR3

Homo sapiens

UniProt Q5RKV6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component RRP40 × 1 （Q9NQT5） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component RRP4 × 1 （Q13868） Isoform 2 of HBS1-like protein × 1 （Q9Y450） Exosome complex component RRP45 × 1 （Q06265） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXOS6_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain G； PDBConstruct 1–272； UniProt 1–272

Exosome complex component RRP4

Homo sapiens

UniProt Q13868

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component RRP40 × 1 （Q9NQT5） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component MTR3 × 1 （Q5RKV6） Isoform 2 of HBS1-like protein × 1 （Q9Y450） Exosome complex component RRP45 × 1 （Q06265） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXOS2_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain I； PDBConstruct 5–297； UniProt 1–293

Isoform 2 of HBS1-like protein

Homo sapiens

UniProt Q9Y450

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component RRP40 × 1 （Q9NQT5） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component MTR3 × 1 （Q5RKV6） Exosome complex component RRP4 × 1 （Q13868） Exosome complex component RRP45 × 1 （Q06265） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HBS1L_HUMAN
Isoform	Q9Y450-2
PDB entities	11
Chains and sequence ranges	Author chain E； PDBConstruct 5–268； UniProt 369–632

Exosome complex component RRP45

Homo sapiens

UniProt Q06265

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component RRP40 × 1 （Q9NQT5） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component MTR3 × 1 （Q5RKV6） Exosome complex component RRP4 × 1 （Q13868） Isoform 2 of HBS1-like protein × 1 （Q9Y450） DIS3-like exonuclease 1 × 1 （Q8TF46）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXOS9_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain K； PDBConstruct 5–443； UniProt 1–439

DIS3-like exonuclease 1

Homo sapiens

UniProt Q8TF46

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP41 × 1 （Q9NPD3） Exosome complex component RRP43 × 1 （Q96B26） Exosome complex component RRP46 × 1 （Q9NQT4） Exosome complex component RRP42 × 1 （Q15024） Exosome complex component RRP40 × 1 （Q9NQT5） Exosome complex component CSL4 × 1 （Q9Y3B2） CrPV-IRES RNA × 1 Helicase SKI2W × 1 （Q15477） Exosome complex component MTR3 × 1 （Q5RKV6） Exosome complex component RRP4 × 1 （Q13868） Isoform 2 of HBS1-like protein × 1 （Q9Y450） Exosome complex component RRP45 × 1 （Q06265）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DI3L1_HUMAN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 3–1056； UniProt 1–1054

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9g8n
Deposition date deposition_date	2024-07-23
Structure title title	80S-bound human Ski2-exosome complex
Keywords keywords	Ribosome, RNase, Helicase, RNA-binding, mRNA-degradation, cytoplasm; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9g8n__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9g8n__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9g8n__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	61.18 Å
Rg (electron density)	61.83 Å
Total Rg	61.65 Å
Atom count	34405
Residues	4348
Excluded volume	610950 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9g8n__assembly_1__model_1`	13-meric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Exosome complex component RRP41
Molecular weight formula_weight	26417.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L
Atom count atom_count	34405

MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLEMDARLHEDHLERVLEAAAQAARDVHTLLDRVVRQHVREASILLGD

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Exosome complex component RRP43
Molecular weight formula_weight	30429.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

GPDSMAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEETALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Exosome complex component RRP46
Molecular weight formula_weight	25636.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

GPDSMEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRALFCGVACALDSDGTLVLDPTSKQEKEARAVLTFALDSVERKLLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYRESLQRRYSKS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Exosome complex component RRP42
Molecular weight formula_weight	32216.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

GPDSMASVTLSEAEKVYIVHGVQEDLRVDGRGCEDYRCVEVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVDLKTLCISPREHCWVLYVDVLLLECGGNLFDAISIAVKAALFNTRIPRVRVLEDEEGSKDIELSDDPYDCIRLSVENVPCIVTLCKIGYRHVVDATLQEEACSLASLLVSVTSKGVVTCMRKVGKGSLDPESIFEMMETGKRVGKVLHASLQSVVHKEESLGPKRQKVGFLG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Exosome complex component RRP40
Molecular weight formula_weight	29940.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

GPDSMAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLHPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Exosome complex component CSL4
Molecular weight formula_weight	21835.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

GPDSMAPPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAIVTCKVSSINSRFAKVHILYVGSMPLKNSFRGTIRKEDVRATEKDKVEIYKSFRPGDIVLAKVISLGDAQSNYLLTTAENELGVVVAHSESGIQMVPISWCEMQCPKTHTKEFRKVARVQPEFLQT

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	CrPV-IRES RNA
Molecular weight formula_weight	13422.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	X

UUUUUUUUUUUUUUUUUUUUUUUUUUCUCCUCUUUUUUUUUUUU

Entity 8 Entity 8 polymer

Description description	Helicase SKI2W
Molecular weight formula_weight	137913.7 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MMETERLVLPPPDPLDLPLRAVELGCTGHWELLNLPGAPESSLPHGLPPCAPDLQQEAEQLFLSSPAWLPLHGVEHSARKWQRKTDPWSLLAVLGAPVPSDLQAQRHPTTGQILGYKEVLLENTNLSATTSLSLRRPPGPASQSLWGNPTQYPFWPGGMDEPTITDLNTREEAEEEIDFEKDLLTIPPGFKKGMDFAPKDCPTPAPGLLSLSCMLEPLDLGGGDEDENEAVGQPGGPRGDTVSASPCSAPLARASSLEDLVLKEASTAVSTPEAPEPPSQEQWAIPVDATSPVGDFYRLIPQPAFQWAFEPDVFQKQAILHLERHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFRDFRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYINDVERGVVWEEVLIMLPDHVSIILLSATVPNALEFADWIGRLKRRQIYVISTVTRPVPLEHYLFTGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVVFTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQRCLARLRGSDRQLPQVLHMSELLNRGLGVHHSGILPILKEIVEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVILLCKGRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSRKDSKAHEQALAELTKRLGALEEPDMTGQLVDLPEYYSWGEELTETQHMIQRRIMESVNGLKSLSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAAVTTAVQELLRLAQAHPAGPPTLDPVNDLQLKDMSVVEGGLRARKLEELIQGAQCVHSPRFPAQYLKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEAGTVKLAGRVACAMSSHELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLYTQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	Exosome complex component MTR3
Molecular weight formula_weight	28267.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYPRAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAGLTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	Exosome complex component RRP4
Molecular weight formula_weight	33190.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

GPDSMAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 polymer

Description description	Isoform 2 of HBS1-like protein
Molecular weight formula_weight	30196.1 kDa
EC 编号 ec_number	3.6.5.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

GPDSSQCESPSLTELFQEHKENNISQCFTLSDLCNQSSASFTDLSLGSFPLSQLANRCQSSPGISELTGSLSSLAFHKASPTRDLENLSLSELIAETIDVDNSQIKKESFEVSLSEVRSPGIDSNIDLSVLIKNPDFVPKPVVDPSIAPSSRTKVLSSKLGKNSNFAKDNKKNNKGSLTRKPPFSLSWTKALAARPSAFASTLCLRYPLKSCKRRTLDLYKTFLYSRQVQDVKDKEISPLVAITPFDFKSASPDDIVKANQKKAFTRELEVLFQ

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 12 Entity 12 polymer

Description description	Exosome complex component RRP45
Molecular weight formula_weight	49370.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

GPDSMKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVSCELVSPKLNRATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITAFKMEKAPIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDLEDSEKEDDEGGGDQAIILDGIKMDTGVEVSDIGSQDAPIILSDSEEEEMIILEPDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAAN

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 13 Entity 13 polymer

Description description	DIS3-like exonuclease 1
Molecular weight formula_weight	121108.6 kDa
EC 编号 ec_number	3.1.13.1
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

GPMLQKREKVLLLRTFQGRTLRIVREHYLRPCVPCHSPLCPQPAACSHDGKLLSSDVTHYVIPDWKVVQDYLEILEFPELKGIIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNYLDNFWPDLKAAHELCDSILQSRRERENESQESHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRLQGASSKDSDLVSDILIHGMKARNRSIHGDVVVVELLPKNEWKGRTVALCENDCDDKASGESPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAETLQDFRVVVRIDSWESTSVYPNGHFVRVLGRIGDLEGEIATILVENSISVIPFSEAQMCEMPVNTPESPWKVSPEEEQKRKDLRKSHLVFSIDPKGCEDVNDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDIEARTRATTYYLADRRYDMLPSVLSADLCSLLGGVDRYAVSIMWELDKASYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNLSVVDDIPEFKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKRDGCGALELEGVEVCVQLDDKKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDNANDPHDPIVNRLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKGNLFSNKDLEELCRHINNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLLFIPRFGIKGAAYLKNKDGLVISCGPDSCSEWKPGSLQRFQNKITSTTTDGESVTFHLFDHVTVRISIQASRCHSDTIRLEIISNKPYKIPNTELIHQSSPLLKSELVKEVTKSVEEAQLAQEVKVNIIQEEYQEYRQTKGRSLYTLLEEIRDLALLDVSNNYGI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	79353

80S-bound human Ski2-exosome complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Exosome complex component RRP41

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component RRP43

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component RRP46

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component RRP42

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component RRP40

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component CSL4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Helicase SKI2W

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component MTR3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component RRP4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Isoform 2 of HBS1-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer