9mo5

Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound partially activated state (lower strand)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin, alpha cardiac muscle 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Troponin C, slow skeletal and cardiac muscles × 1 （P19123） Troponin I, cardiac muscle × 1 （P48787） Isoform A2 of Troponin T, cardiac muscle × 2 （P50752） Tropomyosin alpha-1 chain × 4 （P58771） ADENOSINE-5'-DIPHOSPHATE × 6 MAGNESIUM ION × 6 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACTC_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–377； UniProt 1–377 Author chain B； PDBConstruct 1–377； UniProt 1–377 Author chain C； PDBConstruct 1–377； UniProt 1–377 Author chain D； PDBConstruct 1–377； UniProt 1–377 Author chain E； PDBConstruct 1–377； UniProt 1–377 Author chain F； PDBConstruct 1–377； UniProt 1–377

Troponin C, slow skeletal and cardiac muscles

OrganismNot specified

UniProt P19123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Actin, alpha cardiac muscle 1 × 6 （P68033） Troponin I, cardiac muscle × 1 （P48787） Isoform A2 of Troponin T, cardiac muscle × 2 （P50752） Tropomyosin alpha-1 chain × 4 （P58771） ADENOSINE-5'-DIPHOSPHATE × 6 MAGNESIUM ION × 6 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TNNC1_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–161； UniProt 1–161

Troponin I, cardiac muscle

OrganismNot specified

UniProt P48787

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Actin, alpha cardiac muscle 1 × 6 （P68033） Troponin C, slow skeletal and cardiac muscles × 1 （P19123） Isoform A2 of Troponin T, cardiac muscle × 2 （P50752） Tropomyosin alpha-1 chain × 4 （P58771） ADENOSINE-5'-DIPHOSPHATE × 6 MAGNESIUM ION × 6 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TNNI3_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain H； PDBConstruct 1–211； UniProt 1–211

Isoform A2 of Troponin T, cardiac muscle

OrganismNot specified

UniProt P50752

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Actin, alpha cardiac muscle 1 × 6 （P68033） Troponin C, slow skeletal and cardiac muscles × 1 （P19123） Troponin I, cardiac muscle × 1 （P48787） Tropomyosin alpha-1 chain × 4 （P58771） ADENOSINE-5'-DIPHOSPHATE × 6 MAGNESIUM ION × 6 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TNNT2_MOUSE
Isoform	P50752-3
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–291； UniProt 1–291 Author chain J； PDBConstruct 1–291； UniProt 1–291

Tropomyosin alpha-1 chain

OrganismNot specified

UniProt P58771

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Actin, alpha cardiac muscle 1 × 6 （P68033） Troponin C, slow skeletal and cardiac muscles × 1 （P19123） Troponin I, cardiac muscle × 1 （P48787） Isoform A2 of Troponin T, cardiac muscle × 2 （P50752） ADENOSINE-5'-DIPHOSPHATE × 6 MAGNESIUM ION × 6 CALCIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TPM1_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain K； PDBConstruct 1–284； UniProt 1–284 Author chain L； PDBConstruct 1–284； UniProt 1–284 Author chain M； PDBConstruct 1–284； UniProt 1–284 Author chain N； PDBConstruct 1–284； UniProt 1–284

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9mo5
Deposition date deposition_date	2024-12-25
Structure title title	Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound partially activated state (lower strand)
Keywords keywords	thin filament, cryo-EM, troponin, tropomyosin, muscle structure, motor protein; MOTOR PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9mo5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9mo5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9mo5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	93.86 Å
Rg (electron density)	97.81 Å
Total Rg	97.14 Å
Atom count	25730
Residues	3228
Excluded volume	456740 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9mo5__assembly_1__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Actin, alpha cardiac muscle 1
Molecular weight formula_weight	42064.9 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	25730

MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

Entity 2 Entity 2 polymer

Description description	Troponin C, slow skeletal and cardiac muscles
Molecular weight formula_weight	18437.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Entity 3 Entity 3 polymer

Description description	Troponin I, cardiac muscle
Molecular weight formula_weight	24308.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQEMEREAEERRGEKGRVLRTRCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSGMEGRKKKFEG

Entity 4 Entity 4 polymer

Description description	Isoform A2 of Troponin T, cardiac muscle
Molecular weight formula_weight	34616.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

MSDAEEVVEEYEEEQEEQEEAVEEEEAGGAEPEPEGEAETEEANVEEVGPDEEAKDAEEGPVEDTKPKPSRLFMPNLVPPKIPDGERVDFDDIHRKRVEKDLNELQTLIEAHFENRKKEEEELISLKDRIEKRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARKKKALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKALAIDHLNEDQLREKAKELWQSIHNLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK

Entity 5 Entity 5 polymer

Description description	Tropomyosin alpha-1 chain
Molecular weight formula_weight	32735.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,L,M,N

MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

Entity 6 Entity 6 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 7 Entity 7 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 8 Entity 8 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Resolution resolution	5.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	58362

Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound partially activated state (lower strand)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin, alpha cardiac muscle 1

State in the Current Structure

Other States of the Same Protein in the Database

Troponin C, slow skeletal and cardiac muscles

State in the Current Structure

Other States of the Same Protein in the Database

Troponin I, cardiac muscle

State in the Current Structure

Other States of the Same Protein in the Database

Isoform A2 of Troponin T, cardiac muscle

State in the Current Structure

Other States of the Same Protein in the Database

Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9mo5__assembly_1__model_1

9mo5__assembly_1__model_1 | I(q)

9mo5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)

Structure of native murine cardiac thin filament at pCa=5.8 in Ca2+-bound partially activated state (lower strand)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Actin, alpha cardiac muscle 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Troponin C, slow skeletal and cardiac muscles

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Troponin I, cardiac muscle

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Isoform A2 of Troponin T, cardiac muscle

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tropomyosin alpha-1 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9mo5__assembly_1__model_1

9mo5__assembly_1__model_1 | I(q)

9mo5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)