SAXSdb — 9pgg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

Salmonella phage P22

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Peptidoglycan hydrolase gp4 × 12 （P26746） Portal protein × 12 （P26744）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAPSD_BPP22
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Aa； PDBConstruct 1–430； UniProt 1–430 Author chain Ab； PDBConstruct 1–430； UniProt 1–430 Author chain Ac； PDBConstruct 1–430； UniProt 1–430 Author chain Ad； PDBConstruct 1–430； UniProt 1–430 Author chain Ae； PDBConstruct 1–430； UniProt 1–430 Author chain Af； PDBConstruct 1–430； UniProt 1–430 Author chain Ag； PDBConstruct 1–430； UniProt 1–430 Author chain Ah； PDBConstruct 1–430； UniProt 1–430 Author chain Ai； PDBConstruct 1–430； UniProt 1–430 Author chain Aj； PDBConstruct 1–430； UniProt 1–430 Author chain Ak； PDBConstruct 1–430； UniProt 1–430 Author chain Al； PDBConstruct 1–430； UniProt 1–430 Author chain Am； PDBConstruct 1–430； UniProt 1–430 Author chain An； PDBConstruct 1–430； UniProt 1–430 Author chain Ao； PDBConstruct 1–430； UniProt 1–430

Peptidoglycan hydrolase gp4

Salmonella phage P22

UniProt P26746

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Major capsid protein × 15 （P26747） Portal protein × 12 （P26744）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EXLYS_BPP22
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Ap； PDBConstruct 1–166； UniProt 1–166 Author chain Aq； PDBConstruct 1–166； UniProt 1–166 Author chain Ar； PDBConstruct 1–166； UniProt 1–166 Author chain As； PDBConstruct 1–166； UniProt 1–166 Author chain At； PDBConstruct 1–166； UniProt 1–166 Author chain Au； PDBConstruct 1–166； UniProt 1–166 Author chain Av； PDBConstruct 1–166； UniProt 1–166 Author chain Aw； PDBConstruct 1–166； UniProt 1–166 Author chain Ax； PDBConstruct 1–166； UniProt 1–166 Author chain Ay； PDBConstruct 1–166； UniProt 1–166 Author chain Az； PDBConstruct 1–166； UniProt 1–166 Author chain Ba； PDBConstruct 1–166； UniProt 1–166

Portal protein

Salmonella phage P22

UniProt P26744

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 39	Major capsid protein × 15 （P26747） Peptidoglycan hydrolase gp4 × 12 （P26746）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PORTL_BPP22
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain Bb； PDBConstruct 1–725； UniProt 1–725 Author chain Bd； PDBConstruct 1–725； UniProt 1–725 Author chain Bf； PDBConstruct 1–725； UniProt 1–725 Author chain Bh； PDBConstruct 1–725； UniProt 1–725 Author chain Bj； PDBConstruct 1–725； UniProt 1–725 Author chain Bl； PDBConstruct 1–725； UniProt 1–725 Author chain Bn； PDBConstruct 1–725； UniProt 1–725 Author chain Bp； PDBConstruct 1–725； UniProt 1–725 Author chain Br； PDBConstruct 1–725； UniProt 1–725 Author chain Bt； PDBConstruct 1–725； UniProt 1–725 Author chain Bv； PDBConstruct 1–725； UniProt 1–725 Author chain Bx； PDBConstruct 1–725； UniProt 1–725

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9pgg
Deposition date deposition_date	2025-07-07
Structure title title	Cryo-EM structure of bacteriophage P22 gp1-gp5-gp4 complex at 2.76 angstrom
Keywords keywords	Phage capsid-tail interface, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9pgg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9pgg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9pgg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	81.51 Å
Rg (electron density)	80.99 Å
Total Rg	81.19 Å
Atom count	120038
Residues	15287
Excluded volume	2122500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9pgg__assembly_1__model_1`	39-meric （39）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Major capsid protein
Molecular weight formula_weight	46795.6 kDa
Source method src_method	man
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Aa,Ab,Ac,Ad,Ae,Af,Ag,Ah,Ai,Aj,Ak,Al,Am,An,Ao
Atom count atom_count	120038

MALNEGQIVTLAVDEIIETISAITPMAQKAKKYTPPAASMQRSSNTIWMPVEQESPTQEGWDLTDKATGLLELNVAVNMGEPDNDFFQLRADDLRDETAYRRRIQSAARKLANNVELKVANMAAEMGSLVITSPDAIGTNTADAWNFVADAEEIMFSRELNRDMGTSYFFNPQDYKKAGYDLTKRDIFGRIPEEAYRDGTIQRQVAGFDDVLRSPKLPVLTKSTATGITVSGAQSFKPVAWQLDNDGNKVNVDNRFATVTLSATTGMKRGDKISFAGVKFLGQMAKNVLAQDATFSVVRVVDGTHVEITPKPVALDDVSLSPEQRAYANVNTSLADAMAVNILNVKDARTNVFWADDAIRIVSQPIPANHELFAGMKTTSFSIPDVGLNGIFATQGDISTLSGLCRIALWYGVNATRPEAIGVGLPGQTA

Source Source

Source organism organism	Salmonella phage P22
NCBI taxonomy ID ncbi_taxonomy_id	2908168
Host organism host_organism	Salmonella enterica

Entity 2 Entity 2 polymer

Description description	Peptidoglycan hydrolase gp4
Molecular weight formula_weight	18045.0 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ap,Aq,Ar,As,At,Au,Av,Aw,Ax,Ay,Az,Ba

MQIKTKGDLVRAALRKLGVASDATLTDVEPQSMQDAVDDLEAMMAEWYQDGKGIITGYVFSDDENPPAEGDDHGLRSSAVSAVFHNLACRIAPDYALEATAKIIATAKYGKELLYKQTAISRAKRAPYPSRMPTGSGNSFANLNEWHYFPGEQNADSTTPHDEGNG

Source Source

Source organism organism	Salmonella phage P22
NCBI taxonomy ID ncbi_taxonomy_id	2908168
Host organism host_organism	Salmonella enterica

Entity 3 Entity 3 polymer

Description description	Portal protein
Molecular weight formula_weight	82829.4 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Bb,Bd,Bf,Bh,Bj,Bl,Bn,Bp,Br,Bt,Bv,Bx

MADNENRLESILSRFDADWTASDEARREAKNDLFFSRVSQWDDWLSQYTTLQYRGQFDVVRPVVRKLVSEMRQNPIDVLYRPKDGARPDAADVLMGMYRTDMRHNTAKIAVNIAVREQIEAGVGAWRLVTDYEDQSPTSNNQVIRREPIHSACSHVIWDSNSKLMDKSDARHCTVIHSMSQNGWEDFAEKYDLDADDIPSFQNPNDWVFPWLTQDTIQIAEFYEVVEKKETAFIYQDPVTGEPVSYFKRDIKDVIDDLADSGFIKIAERQIKRRRVYKSIITCTAVLKDKQLIAGEHIPIVPVFGEWGFVEDKEVYEGVVRLTKDGQRLRNMIMSFNADIVARTPKKKPFFWPEQIAGFEHMYDGNDDYPYYLLNRTDENSGDLPTQPLAYYENPEVPQANAYMLEAATSAVKEVATLGVDTEAVNGGQVAFDTVNQLNMRADLETYVFQDNLATAMRRDGEIYQSIVNDIYDVPRNVTITLEDGSEKDVQLMAEVVDLATGEKQVLNDIRGRYECYTDVGPSFQSMKQQNRAEILELLGKTPQGTPEYQLLLLQYFTLLDGKGVEMMRDYANKQLIQMGVKKPETPEEQQWLVEAQQAKQGQQDPAMVQAQGVLLQGQAELAKAQNQTLSLQIDAAKVEAQNQLNAARIAEIFNNMDLSKQSEFREFLKTVASFQQDRSEDARANAELLLKGDEQTHKQRMDIANILQSQRQNQPSGSVAETPQ

Source Source

Source organism organism	Salmonella phage P22
NCBI taxonomy ID ncbi_taxonomy_id	2908168
Host organism host_organism	Salmonella enterica

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.76 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	93834

Cryo-EM structure of bacteriophage P22 gp1-gp5-gp4 complex at 2.76 angstrom

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Peptidoglycan hydrolase gp4

State in the Current Structure

Other States of the Same Protein in the Database

Portal protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9pgg__assembly_1__model_1

9pgg__assembly_1__model_1 | I(q)

9pgg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

Cryo-EM structure of bacteriophage P22 gp1-gp5-gp4 complex at 2.76 angstrom

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Peptidoglycan hydrolase gp4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Portal protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9pgg__assembly_1__model_1

9pgg__assembly_1__model_1 | I(q)

9pgg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)