← Back to search

9spq

p53 cancer mutant V272M in complex with DARPin C10

Method: X-RAY DIFFRACTION D_max: 74.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9spq
deposition_date	2025-09-17
last_revision	2026-04-22
title	p53 cancer mutant V272M in complex with DARPin C10
keywords	;p53, tumor suppressor, cancer mutation, protein stability, protein unfolding disease, designed ankyrin repeat proteins, thermostabilization, mutant p53 reactivation, cancer therapy, TRANSCRIPTION ;; TRANSCRIPTION
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	21.56 Å
rg_electron	20.56 Å
i0	22907200.00
molecular_weight	34826.0 kDa
excluded_volume	42927 Å³
envelope_volume	50737 Å³
shell_volume	20931 Å³
envelope_diameter	73.8 Å
shell_rg	26.84 Å
envelope_rg	20.70 Å
shape_rg	20.54 Å
total_rg	21.41 Å
total_atoms	2438
n_residues	321
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	74.3 Å
rg_real	21.54 Å
rg_real_error	0.48 Å
i0_real	2.2910e+07
i0_real_error	3.1840e+05
rg_reciprocal	21.55 Å
i0_reciprocal	22910000.0000
total_estimate	0.8711
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	73.2 Å
skewness	0.352
kurtosis	-0.322
angular_range	— – 0.3700 Å⁻¹
current_alpha	0.0000
highest_alpha	5270000.0000
n_real_points	69
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.791; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.956; Smooth: 0.991

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Cellular tumor antigen p53
formula_weight	22753.8 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2586

SSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEMRVCACPGRDRRTEEENLRKKGE

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 polymer

description	DARPin C10
formula_weight	13527.3 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	E

GSDLGKKLLEAAWHGQDDEVRILMANGADVNATDQSGMTPLHLAAWRGHLEIVEVLLKTGADVNAIDRWGKTPLHLAARIGHLEIVEVLLKAGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAA

Source

organism	synthetic construct
ncbi_taxonomy_id	32630
host_organism	Escherichia coli

Entity 3 non-polymer

description	ZINC ION
formula_weight	65.4 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	1,2-ETHANEDIOL
formula_weight	62.1 kDa
src_method	syn
entity_count	2

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	148

▶

6. Citations (1)

▶

length_a	38.041 Å
length_b	93.877 Å
length_c	53.552 Å
angle_alpha	90.00 °
angle_beta	109.75 °
angle_gamma	90.00 °
z_pdb	2

space_group	P 1 21 1
int_tables_number	4
crystal_system	monoclinic

resolution	2.200 Å
resolution_low	46.940 Å
r_factor	0.1774
r_work	0.1751
r_free	0.2224

fit	/app/data/saxs_computation/sp/9spq/9spq.fit
pddf	/app/data/pr_computation/sp/9spq/9spq.pr.out
profile	/app/data/saxs_computation/sp/9spq/9spq.dat

p53 cancer mutant V272M in complex with DARPin C10

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (5)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

Entity 4 non-polymer

Entity 5 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)