← Back to search

9tfu

Crystal structure of beta-TrCP bound by monophosphorylated ATF4 degron peptide

Method: X-RAY DIFFRACTION D_max: 71.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9tfu
deposition_date	2025-11-27
title	Crystal structure of beta-TrCP bound by monophosphorylated ATF4 degron peptide
keywords	E3 ligase, phosphodegron, beta-TrCP, ATF4, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	21.79 Å
rg_electron	20.97 Å
i0	29379200.00
molecular_weight	40725.0 kDa
excluded_volume	50544 Å³
envelope_volume	58239 Å³
shell_volume	23157 Å³
envelope_diameter	72.6 Å
shell_rg	27.77 Å
envelope_rg	21.14 Å
shape_rg	20.96 Å
total_rg	21.79 Å
total_atoms	2856
n_residues	357
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	71.3 Å
rg_real	21.72 Å
rg_real_error	0.43 Å
i0_real	2.9380e+07
i0_real_error	3.8840e+05
rg_reciprocal	21.73 Å
i0_reciprocal	29380000.0000
total_estimate	0.8899
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	26.6 Å
skewness	0.288
kurtosis	-0.282
angular_range	— – 0.3650 Å⁻¹
current_alpha	0.0000
highest_alpha	9720000.0000
n_real_points	68
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.858; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.995

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	F-box/WD repeat-containing protein 1A
formula_weight	41829.7 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	3004

GSGMEWKKEIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLN

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Spodoptera frugiperda

Entity 2 polymer

description	Cyclic AMP-dependent transcription factor ATF-4
formula_weight	1421.4 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

SDNDSGICMSPES

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	synthetic construct

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	148

▶

6. Citations (1)

▶

length_a	44.986 Å
length_b	47.146 Å
length_c	150.913 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	1.997 Å
resolution_low	75.460 Å
r_factor	0.1968
r_work	0.1945
r_free	0.2356

fit	/app/data/saxs_computation/tf/9tfu/9tfu.fit
pddf	/app/data/pr_computation/tf/9tfu/9tfu.pr.out
profile	/app/data/saxs_computation/tf/9tfu/9tfu.dat

Crystal structure of beta-TrCP bound by monophosphorylated ATF4 degron peptide

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)