9wbg

Structure of human 26S proteasome complexed with midnolin, 19S proteasome with Ubl and Catch domain resolved

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Maltose/maltodextrin-binding periplasmic protein,Midnolin

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MALE_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain f； PDBConstruct 9–374； UniProt 27–392

Maltose/maltodextrin-binding periplasmic protein,Midnolin

Homo sapiens

UniProt Q504T8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MIDN_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain f； PDBConstruct 389–856； UniProt 1–468

26S proteasome regulatory subunit 8

OrganismNot specified

UniProt P62195

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS8_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–406； UniProt 1–406

26S proteasome regulatory subunit 6B

OrganismNot specified

UniProt P43686

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6B_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–418； UniProt 1–418

26S proteasome non-ATPase regulatory subunit 3

OrganismNot specified

UniProt O43242

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD3_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain V； PDBConstruct 1–534； UniProt 1–534

26S proteasome non-ATPase regulatory subunit 12

OrganismNot specified

UniProt O00232

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD12_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain W； PDBConstruct 1–456； UniProt 1–456

26S proteasome non-ATPase regulatory subunit 11

OrganismNot specified

UniProt O00231

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD11_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain X； PDBConstruct 1–422； UniProt 1–422

26S proteasome non-ATPase regulatory subunit 6

OrganismNot specified

UniProt Q15008

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD6_HUMAN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain Y； PDBConstruct 1–389； UniProt 1–389

26S proteasome non-ATPase regulatory subunit 7

OrganismNot specified

UniProt P51665

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD7_HUMAN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain Z； PDBConstruct 1–324； UniProt 1–324

26S proteasome non-ATPase regulatory subunit 13

OrganismNot specified

UniProt Q9UNM6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSD13_HUMAN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain a； PDBConstruct 1–376； UniProt 1–376

26S proteasome non-ATPase regulatory subunit 4

OrganismNot specified

UniProt P55036

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD4_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain b； PDBConstruct 1–377； UniProt 1–377

26S proteasome non-ATPase regulatory subunit 8

OrganismNot specified

UniProt P48556

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD8_HUMAN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain d； PDBConstruct 1–350； UniProt 1–350

26S proteasome complex subunit SEM1

OrganismNot specified

UniProt P60896

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SEM1_HUMAN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain e； PDBConstruct 1–70； UniProt 1–70

26S proteasome non-ATPase regulatory subunit 1

OrganismNot specified

UniProt Q99460

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSMD1_HUMAN
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain U； PDBConstruct 1–953； UniProt 1–953

Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein

Pseudotamlana agarivorans

UniProt A0ACC5U4E7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0ACC5U4E7_9FLAO
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain c； PDBConstruct 319–554； UniProt 1–236

Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein

Pseudotamlana agarivorans

UniProt O00487

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSDE_HUMAN
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain c； PDBConstruct 1–310； UniProt 1–310

26S proteasome regulatory subunit 7

OrganismNot specified

UniProt P35998

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS7_HUMAN
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain A； PDBConstruct 1–433； UniProt 1–433

26S proteasome regulatory subunit 4

OrganismNot specified

UniProt P62191

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 10B × 1 （P62333） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS4_HUMAN
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain B； PDBConstruct 1–440； UniProt 1–440

26S proteasome regulatory subunit 10B

OrganismNot specified

UniProt P62333

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 6A × 1 （P17980） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS10_HUMAN
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain E； PDBConstruct 1–389； UniProt 1–389

26S proteasome regulatory subunit 6A

OrganismNot specified

UniProt P17980

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 20	Maltose/maltodextrin-binding periplasmic protein,Midnolin × 1 （P0AEX9,Q504T8） 26S proteasome regulatory subunit 8 × 1 （P62195） 26S proteasome regulatory subunit 6B × 1 （P43686） 26S proteasome non-ATPase regulatory subunit 3 × 1 （O43242） 26S proteasome non-ATPase regulatory subunit 12 × 1 （O00232） 26S proteasome non-ATPase regulatory subunit 11 × 1 （O00231） 26S proteasome non-ATPase regulatory subunit 6 × 1 （Q15008） 26S proteasome non-ATPase regulatory subunit 7 × 1 （P51665） 26S proteasome non-ATPase regulatory subunit 13 × 1 （Q9UNM6） 26S proteasome non-ATPase regulatory subunit 4 × 1 （P55036） 26S proteasome non-ATPase regulatory subunit 8 × 1 （P48556） 26S proteasome complex subunit SEM1 × 1 （P60896） Substrate × 1 26S proteasome non-ATPase regulatory subunit 1 × 1 （Q99460） Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein × 1 （A0ACC5U4E7,O00487） 26S proteasome regulatory subunit 7 × 1 （P35998） 26S proteasome regulatory subunit 4 × 1 （P62191） 26S proteasome regulatory subunit 10B × 1 （P62333） Early growth response protein 1 × 1 ADENOSINE-5'-DIPHOSPHATE × 2 ADENOSINE-5'-TRIPHOSPHATE × 4 ZINC ION × 1 MAGNESIUM ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PRS6A_HUMAN
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain F； PDBConstruct 1–439； UniProt 1–439

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9wbg
Deposition date deposition_date	2025-08-14
Structure title title	Structure of human 26S proteasome complexed with midnolin, 19S proteasome with Ubl and Catch domain resolved
Keywords keywords	proteasome, midnolin, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9wbg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9wbg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9wbg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	66.47 Å
Rg (electron density)	66.17 Å
Total Rg	66.25 Å
Atom count	50206
Residues	6310
Excluded volume	898320 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9wbg__assembly_1__model_1`	20-meric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (24)

Entity 1 Entity 1 polymer

Description description	Maltose/maltodextrin-binding periplasmic protein,Midnolin
Molecular weight formula_weight	92188.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f
Atom count atom_count	50206

MGHHHHHHKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTDYDIPTTENLYFQGMEPQPGGARSCRRGAPGGACELGPAAEAAPMSLAIHSTTGTRYDLAVPPDETVEGLRKRLSQRLKVPKERLALLHKDTRLSSGKLQEFGVGDGSKLTLVPTVEAGLMSQASRPEQSVMQALESLTETQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAARGDPSIASPVSSPCRPVSSAARVPPVPTSPSPASPSPITAGSFRSHAASTTCPEQMDCSPTASSSASPGASTTSTPGASPAPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWSPSRKAGRSDSSSSGGGGSPSEASGLGLDFEDSVWKPEVNPDIKSEFVVA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli K-12

Entity 2 Entity 2 polymer

Description description	26S proteasome regulatory subunit 8
Molecular weight formula_weight	45694.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLREELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK

Entity 3 Entity 3 polymer

Description description	26S proteasome regulatory subunit 6B
Molecular weight formula_weight	47426.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDLEDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK

Entity 4 Entity 4 polymer

Description description	26S proteasome non-ATPase regulatory subunit 3
Molecular weight formula_weight	61066.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MKQEGSARRRGADKAKPPPGGGEQEPPPPPAPQDVEMKEEAATGGGSTGEADGKTAAAAAEHSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAASTPLLPEVEAYLQLLVVIFMMNSKRYKEAQKISDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHARLRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGRIKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLKRSLMPYFLLTQAVRTGNLAKFNQVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSYSRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP

Entity 5 Entity 5 polymer

Description description	26S proteasome non-ATPase regulatory subunit 12
Molecular weight formula_weight	52979.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDMVSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPIKLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKKERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSYLSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIPKYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ

Entity 6 Entity 6 polymer

Description description	26S proteasome non-ATPase regulatory subunit 11
Molecular weight formula_weight	47526.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT

Entity 7 Entity 7 polymer

Description description	26S proteasome non-ATPase regulatory subunit 6
Molecular weight formula_weight	45592.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM

Entity 8 Entity 8 polymer

Description description	26S proteasome non-ATPase regulatory subunit 7
Molecular weight formula_weight	37086.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKEKK

Entity 9 Entity 9 polymer

Description description	26S proteasome non-ATPase regulatory subunit 13
Molecular weight formula_weight	42995.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQTLKTAWGQQPDLAANEAQLLRKIQLLCLMEMTFTRPANHRQLTFEEIAKSAKITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVLDLQQIKGMKDRLEFWCTDVKSMEMLVEHQAHDILT

Entity 10 Entity 10 polymer

Description description	26S proteasome non-ATPase regulatory subunit 4
Molecular weight formula_weight	40781.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLADALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLASQATKDGKKDKKEEDKK

Entity 11 Entity 11 polymer

Description description	26S proteasome non-ATPase regulatory subunit 8
Molecular weight formula_weight	39667.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MFIKGRAPRAPPRERRRATRGGLRQVVAPPRALGSTSRPHFRRASVCRRRCRKSGGLLAASRKMAAAAVNGAAGFSSSGPAATSGAVLQAATGMYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Entity 12 Entity 12 polymer

Description description	26S proteasome complex subunit SEM1
Molecular weight formula_weight	8284.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS

Entity 13 Entity 13 polymer

Description description	Substrate
Molecular weight formula_weight	613.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

XXXXXXX

Entity 14 Entity 14 polymer

Description description	26S proteasome non-ATPase regulatory subunit 1
Molecular weight formula_weight	105958.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MITSAAGIISLLDEDEPQLKEFALHKLNAVVNDFWAEISESVDKIEVLYEDEGFRSRQFAALVASKVFYHLGAFEESLNYALGAGDLFNVNDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETEEKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARATNWAKFTATASLGVIHKGHEKEALQLMATYLPKDTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLKNASNDIVRHGGSLGLGLAAMGTARQDVYDLLKTNLYQDDAVTGEAAGLALGLVMLGSKNAQAIEDMVGYAQETQHEKILRGLAVGIALVMYGRMEEADALIESLCRDKDPILRRSGMYTVAMAYCGSGNNKAIRRLLHVAVSDVNDDVRRAAVESLGFILFRTPEQCPSVVSLLSESYNPHVRYGAAMALGICCAGTGNKEAINLLEPMTNDPVNYVRQGALIASALIMIQQTEITCPKVNQFRQLYSKVINDKHDDVMAKFGAILAQGILDAGGHNVTISLQSRTGHTHMPSVVGVLVFTQFWFWFPLSHFLSLAYTPTCVIGLNKDLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD

Entity 15 Entity 15 polymer

Description description	Ubiquitin C-terminal hydrolase PSMD14,Uncharacterized protein
Molecular weight formula_weight	66145.2 kDa
EC 编号 ec_number	3.4.19.12
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFKENLYFQGAMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYKHHHHHHSAWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Source Source

Source organism organism	Pseudotamlana agarivorans
NCBI taxonomy ID ncbi_taxonomy_id	481183
Host organism host_organism	Escherichia coli K-12

Entity 16 Entity 16 polymer

Description description	26S proteasome regulatory subunit 7
Molecular weight formula_weight	48700.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN

Entity 17 Entity 17 polymer

Description description	26S proteasome regulatory subunit 4
Molecular weight formula_weight	49260.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRLKLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPEGLYL

Entity 18 Entity 18 polymer

Description description	26S proteasome regulatory subunit 10B
Molecular weight formula_weight	44241.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV

Entity 19 Entity 19 polymer

Description description	26S proteasome regulatory subunit 6A
Molecular weight formula_weight	49266.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA

Entity 20 Entity 20 polymer

Description description	Early growth response protein 1
Molecular weight formula_weight	37159.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli K-12

Entity 21 Entity 21 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 22 Entity 22 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 23 Entity 23 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 24 Entity 24 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.23 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	7251

Structure of human 26S proteasome complexed with midnolin, 19S proteasome with Ubl and Catch domain resolved

1. Protein Identity and Related Structures Protein Identity & Related Structures

Maltose/maltodextrin-binding periplasmic protein,Midnolin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Maltose/maltodextrin-binding periplasmic protein,Midnolin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome regulatory subunit 6B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

26S proteasome non-ATPase regulatory subunit 13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer