9ynw

Tra1, Core and minimal HAT modules of ctSAGA, composite.

Method: ELECTRON MICROSCOPY D_max: 251.5 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Non-specific serine/threonine protein kinase

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain A； UniProt 1–3893	Not recorded	Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNU Tra1 and core modules including core tip of ctSAGA complex Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain A 1–3893（3893 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9YOL Tra1 module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–3893（3893 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9YOQ Core module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain A 1–3893（3893 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0S842_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–3893； UniProt 1–3893

Spt20-like SEP domain-containing protein

OrganismNot specified

UniProt G0RYM2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain B； UniProt 1–1192	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNU Tra1 and core modules including core tip of ctSAGA complex Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain B 1–1192（1192 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9YOL Tra1 module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–1192（1192 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9YOQ Core module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain B 1–1192（1192 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0RYM2_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1192； UniProt 1–1192

Uncharacterized protein

OrganismNot specified

UniProt G0S660

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain C； UniProt 1–433	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNU Tra1 and core modules including core tip of ctSAGA complex Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain C 1–433（433 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9YOL Tra1 module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 1–433（433 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9YOQ Core module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain C 1–433（433 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0S660_CHATD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–433； UniProt 1–433

Transcription initiation factor TFIID subunit 5

OrganismNot specified

UniProt G0SH10

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain D； UniProt 1–767	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNU Tra1 and core modules including core tip of ctSAGA complex Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain D 1–767（767 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9YOQ Core module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain D 1–767（767 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0SH10_CHATD
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–767； UniProt 1–767

Transcription initiation factor TFIID subunit 6

OrganismNot specified

UniProt G0S770

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain E； UniProt 1–480	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNU Tra1 and core modules including core tip of ctSAGA complex Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain E 1–480（480 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9YOQ Core module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain E 1–480（480 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0S770_CHATD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–480； UniProt 1–480

Transcription initiation factor TFIID subunit 10

OrganismNot specified

UniProt G0RYR4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain G； UniProt 1–204	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNU Tra1 and core modules including core tip of ctSAGA complex Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain G 1–204（204 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9YOQ Core module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain G 1–204（204 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0RYR4_CHATD
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–204； UniProt 1–204

Transcription initiation factor TFIID subunit 12

OrganismNot specified

UniProt G0S2A1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain I； UniProt 1–770	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNU Tra1 and core modules including core tip of ctSAGA complex Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain I 1–770（770 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9YOL Tra1 module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain I 1–770（770 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9YOQ Core module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain I 1–770（770 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0S2A1_CHATD
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–770； UniProt 1–770

Putative transcriptional activator protein

OrganismNot specified

UniProt G0S267

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain K； UniProt 1–1196	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNU Tra1 and core modules including core tip of ctSAGA complex Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain K 1–1196（1196 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0S267_CHATD
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–1196； UniProt 1–1196

SCA7 domain-containing protein

OrganismNot specified

UniProt G0S6A1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain Q； UniProt 1–1273	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNU Tra1 and core modules including core tip of ctSAGA complex Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain Q 1–1273（1273 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9YOL Tra1 module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain Q 1–1273（1273 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9YOQ Core module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain Q 1–1273（1273 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0S6A1_CHATD
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Q； PDBConstruct 1–1273； UniProt 1–1273

Putative transcriptional coactivator HFI1 protein

OrganismNot specified

UniProt G0SED0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain H； UniProt 1–485	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNU Tra1 and core modules including core tip of ctSAGA complex Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain H 1–485（485 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9YNV Histone Acetyl Transferase (HAT) module of ctSAGA Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 1–485（485 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
9YOL Tra1 module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain H 1–485（485 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9YOQ Core module of ctSAGA Deposited 2025-10-13	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain H 1–485（485 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0SED0_CHATD
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain H； PDBConstruct 1–485； UniProt 1–485

Transcriptional adapter 2

OrganismNot specified

UniProt G0S7B2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain M； UniProt 1–519	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） histone acetyltransferase × 1 （G0SCB2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNV Histone Acetyl Transferase (HAT) module of ctSAGA Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain M 1–519（519 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
9YZY ctSAGA Focused on HAT Bromodomain region Deposited 2025-10-30	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain M 1–519（519 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0S7B2_CHATD
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 1–519； UniProt 1–519

histone acetyltransferase

OrganismNot specified

UniProt G0SCB2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain N； UniProt 1–405	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） Uncharacterized protein × 1 （G0SD59）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNV Histone Acetyl Transferase (HAT) module of ctSAGA Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain N 1–405（405 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
9YZY ctSAGA Focused on HAT Bromodomain region Deposited 2025-10-30	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain N 1–405（405 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0SCB2_CHATD
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain N； PDBConstruct 1–405； UniProt 1–405

Uncharacterized protein

OrganismNot specified

UniProt G0SD59

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain O； UniProt 1–730	Not recorded	Non-specific serine/threonine protein kinase × 1 （G0S842） Spt20-like SEP domain-containing protein × 1 （G0RYM2） Uncharacterized protein × 1 （G0S660） Transcription initiation factor TFIID subunit 5 × 1 （G0SH10） Transcription initiation factor TFIID subunit 6 × 1 （G0S770） Putative transcription initiation factor × 1 Transcription initiation factor TFIID subunit 10 × 1 （G0RYR4） Transcription initiation factor TFIID subunit 12 × 1 （G0S2A1） Putative transcriptional activator protein × 1 （G0S267） SCA7 domain-containing protein × 1 （G0S6A1） Putative transcriptional coactivator HFI1 protein × 1 （G0SED0） Transcriptional adapter 2 × 1 （G0S7B2） histone acetyltransferase × 1 （G0SCB2）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9YNW	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9YNV Histone Acetyl Transferase (HAT) module of ctSAGA Deposited 2025-10-12	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain O 1–730（730 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
9YZY ctSAGA Focused on HAT Bromodomain region Deposited 2025-10-30	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain O 1–730（730 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.40 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	G0SD59_CHATD
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain O； PDBConstruct 1–730； UniProt 1–730

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ynw
Deposition date deposition_date	2025-10-12
Structure title title	Tra1, Core and minimal HAT modules of ctSAGA, composite.
Keywords keywords	ctSAGA complex, Histone Acetyl Transferase (HAT) Module, Tra1 module and Core module, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	92.26 Å
Radius of gyration Rg (electron density) rg_electron	93.01 Å
Forward intensity I(0) i0	10057200000.00
Molecular weight molecular_weight	863880.0 kDa
Excluded volume excluded_volume	1086000 Å³
Envelope volume envelope_volume	1978300 Å³
Hydration-shell volume shell_volume	184500 Å³
Envelope diameter envelope_diameter	313.3 Å
Shell Rg shell_rg	80.19 Å
Envelope Rg envelope_rg	90.82 Å
Shape Rg shape_rg	92.98 Å
Total Rg total_rg	92.96 Å
Total atoms total_atoms	121271
Residues n_residues	7568
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	251.5 Å
Rg (real space) rg_real	89.02 Å
Rg uncertainty (real space) rg_real_error	0.83 Å
I(0) (real space) i0_real	9.6520e+09
I(0) uncertainty (real space) i0_real_error	1.8790e+08
Rg (reciprocal space) rg_reciprocal	88.97 Å
I(0) (reciprocal space) i0_reciprocal	9952000000.0000
Solution quality estimate total_estimate	0.9154
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	88.8 Å
Skewness Skewness skewness	0.335
Kurtosis Kurtosis kurtosis	-0.663
Angular range angular_range	— – 0.0850 Å⁻¹
Current regularization parameter α current_alpha	1.2000
Highest regularization parameter α highest_alpha	392300000.0000
Real-space data points n_real_points	18
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.999; Stabil: 0.969; Sysdev: 1.000; Positv: 1.000; Valcen: 0.993; Smooth: 0.005

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	Non-specific serine/threonine protein kinase
Molecular weight formula_weight	444670.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	121271

MATSLIEDVVKKLSVAETGTGNSLSERSLLVLPLMQVSCYTELKVKAEAACALRDSLDHYTAGPAYPAFLKKVMPVFIHILRQQPVFQTTGEQGHMQKLRNCILEILHRLPTSQTPPEHFEPYAHEIVDLLLELVRTDNEDNVILCVKILSDIMRHQHKIMSGKVQTFLNLIQELFEQLDKVVRDQLDNTSTTGPPGPPSTPGSTQSSFLPHQQSPRPGSPVTTGVTDFGADANQQANRLLPRGMYSFKVLAECPIIVVSIFQVHRSAVTPNVKAFVPLIKSALLCQAKAQDQAHREAAARGTIHIGVSPNIKNRAAFGDFITAQVKTMSFLAYLLRQYSSQLSDFLPHLPDIIVRLLRDCPRDKSSARKELFVAIRHIINFNFRKIFLPKIDELLDERTLVGDGLTVHETMRPLAYSMLADLIHHVRDQLSPEQIRKTVEVYTRNLQDNFPGTSFQTMSAKLLLNMAECIARLPNKVDARHYLIMILNAIADKFAAMNRQYPNAVKLSKQYAQQAAKNVPETYLADKENPPDWDEIDIFNATPIKISNPRDRAADPVVDNKFLFRNLMTGLKNTFYQLKSCNIPGAVDLTGAPAHWTDVAYGFTAEEVKVIAKLFREGAYVFRYYEIEKPAAESPYSSPVEYMANFYMVSSSKEEKELLETFATVFHCIDPATFHEVFQQEIPRLYEMIHEHTALLHIPQFFLASEATSPSFCGILLRFLMERIEDVGSADIKKSSILLRLFKLAFMAVTLFANQNEQVLLPHVVDIVTKSIELSTKAEEPMNYFLLLRSLFRSIGGGKFEHLYKQILPLLEMLLDVLNNLLMAARKPAERDLYVELCLTVPARLSNLLPHLSFLMRPLVVALRAGTELVGQGLRTLELCVDNLTADYLDPIMAPVIDELMTALFDHLKPHPYSHFHAHTTLRILGKLGGRNRKFMTEALPVTFQQYVDDRASFDLRLIGSKRDRAFPAHLGIDLAIQKLTEIPKPVKGGVPQLSRQYDPYYKRQALNLIIAQTKLRVGFDSVPEDLPRLVRLQVEDLVKKNRDVDISLFEVSDKERSIAKKNEEQALLKRLLKALLYAESIPEFKQEVDALLVNLARHFTLIEIGRSVIDMKKAYTPFDTKSGEGPLFIDNRVLSEAILESLANENLEVREAAKRLIKEMHNAAVTVFGSPMHVPRMTFWSSLASTFCHGCYEEEWFTKQGGALGIQTLLTEIDLGDLWVAAKQIEFVRALMYVVKDMPQDLPEKTRRTAQVTLEQLLARITRNAKKQDCLPPPPPPAPPGSHPPQPPPRPPRLAQLVMMLNSELAHMNRHVRATARRSIEAIAAAAQAEVWELLEPHKKHILGPIYAKPLRALPFAIQIGYIDAVTYYMSLKRDFVPFDENLNRLLMESLALADASDESLAGKTLEFRTHDFIVNLRVSCIKILSRAMSFEEFGSGSNNPTRPKVVSVFFKCLYSDSQPTIDAANDALKAVLQHTTKLPKDLLQSGLRPVLASLQDAKRLTVHSLDNLGRLLRLLTTYFKVEIGTRLLEHVKQIADPNFLQQLSFTFFEQNNAMKVIAAVFNIFHLLPDAARQFKERVIDNVLDLEQKLRRTHHSPFRLPLYKYLNKYPSDIWAFTLQKLEDLRYGRFLAQVLRHPDSQVLRDYGAANVEFIIKTCNTVVVSGKETKFIAIINTINMLDALCQFPTANSQSWLDNKEHIEWLKTVGKELELQQKKNSLTPNLRLPAHQASEQLMNILTKALDRNPNDLDALFSLVEGITSDDFRETPALLSHIYNKIIRSDSIDFWRITILRCLDIYSGKTASQRMKWYLLHNIVNPIIAMDVMRTWDDPNKASRLLDRTVIDSINTKIWKVNLPDPQEDLLQPRVDHTRMEVLQLSAMLVKYRHALLQDARKDFIKFAWTYIRLDDVINKHAAYVVIGYFIAHYETPAKIVSQIYFSLLKTNQNEGRALVTQALELMAPVMPKRCPFPPGDRNPVWALAPRRILAEESQNVQQMTAIFHYLVRHPDLFYDTRDKFAMLIIQCLRKVASPPNPSNDNRKLALNMMWLIWQWEQRRVESKLSEPLRAPSESPNSNKRKLDEQQGLSPSATRQAEFQIPSVGRHKMIRYLVEFIAQLNERYPLPSARPSDPPTTTSFLLPSPSNELCKKATALLYNLLQPQYWGDLVEEMDLFPNVTDLVLAGEKSATLLSADPSDPEKCDDKLITSIINTLQVVRIVLHFKSDRWILDNMPQIQKILEKCLKSANPEIQDCLHMADRKYDGDRDVKPTIKRILDAVPEDIPMEDADGDIEPESQTSELIAWLSGIATESMAAGNYVSGINILWSLGHRKPSIIDQHIPAIMRSLQSKLARDHVSHYAALGHQASGLRPQADPNAPTEMKAYDLEIQTNLILKAIEVTAMRMEILGDNRRPFLSVLATIVEKSLHIPLCEKILEMVEGWVFRSEGTWPTLKEKTAVLHKMISFEHRTDPTMLHKFLNLVLRIYEDPKITRTELTVRMEHAFLIGTRAQDVEMRNKFMSIFDKCLSKTASARLAYVILGQNWDTLADSYWLAQASQLLLGAVDMNPTIQLHQDDFRTLPISQLVAPYAKDSREPSVMIDDKFEAFMANHRRFLAELGDVRARDVLEPLMQLQHIDANFAHELWVALFPMFWSAVPKEDRPDLERGLVTLLTKDYHSRQMDKRPNVVQSLMAGAVKTWPHCKIPPHVLKFEAKTYDAWYTALHQLENAAIKPEIDSAAVRESNLDALVDLYSTLGEDDLFYGTWRRRCQFVETNAGLSYEQHGMWEKAQRMYESAQIKARTGVIPFSEAEYMLWEDHWVLCAQKLQQWEILQDFAKHENFQDLLLECAWRNTEYWQNQENRDQLDTVIKGVMDAPTPRRYFFQAFMSLLKLHNKQETPQDFNRVVDEAIQLSIRKWHQLPKRLTAAHVPLLQNFQQLVELHDASVICQSLAQTNASNLDVKSGELKLLLGSWRDRLPNMWDDIVAWQDLVTWRQHVFGLINATYLQLIPQQAQNAGGASFAYRGYHETAWIINRFAHVARKHALPEVCISQLSRIYTLPNIEIQEAFLKLREQAKCHYQNPDELTSGLDVINNTNLNYFSAPQKAEFYTLKGMFLEKLGQKEEADTAFGTALYFDITAAKAWAEWGYFNDRKFKENPSDLPSAKQALTSYLQAASSYKNHKSRKLIARILWLLSLDDANGTIAAGFDDFKGEIYVWWWIIFIPQLLVGLGYKEAPRVQAILLKIAKTYPQALYFLLRTNREDMLTIKKNQEAKERARQRAAQAAIPNKPNGSPQLTKKDGAAGAADGRPPTANGETPKPPEIKIEGAAPNAPTAATPQAAANAPQVPGAAPAEQQTGGVQKKPPWELTEEIMSVLKTAFPLLALSMETMVDQIQKHFKCPPDEDAYRLIVALLNDGLSYVSRMPASYAKDVKLPAATENNITRFAETILPNHIRPTFEADFVKVKPTMYEYIHNLRKWRDKFEEKLDRRASPAPLESFAHYSPHLSEFRYQKFDDVEIPGQYLQHKDKNQDFIRIDRFLPNVDLVRTIGASHRRLRIRGHDGSVHAFAVQHPAARHCRREERVLQLFRQLNQTLANKKESRRRDLQFTLPLMVPLAPHIRIVQEDTSYITLQSVYEDHCRRHGMNKDEPILFTMEKLRGLMDAKALQKPEQAVTAKLEVYRAIQEKFVDHTIVLEYFQGAYPNFADFWLFRRRFSYQLAALTFMTYTMHIDKRYPHKMNIARGSGNIWGSEAVSYMAPSRPLFQNTEPVPFRLTPNLQTLMGPLATEGIFAASVMAIARCLTEPEQHLEHALTLFVRDEMMFWFTNSHRTMSLTENQLRETVQANCDMIVKKALALAQTPQGNLPAHQTVTDLIAKATNPMNLALCDALWMPYL

Entity 2 Entity 2 polymer

Description description	Spt20-like SEP domain-containing protein
Molecular weight formula_weight	128449.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAPTVTAAAPPVNPPSATKVKRPIPPGIQTNGVAPSRSSPSPSMAAKRAPSAVRQPSNPPSAGGTTPGATRPTIRIRRDPGPGPPLGRGQRSAGLRSASIATDPVTSPTFDAPPYVITPEYILKKFAGHPPSLIVHLYQNHFRFDQQEGMFQYKSPMRIFIEHLRNRTVPHEIMEYLIQGGVPFYEGCLIVQVFDHRTVNQTKEAAKPSSESSKTVPFSIHNHNPYITPSPYVPYPKEDTPADGSQTPASEKPSEDKDKENMPAPPVPADGQKAKGEPAKPTVYTVVLMPTAQALHTDLLLKTVTPRGASDSGGPPPTPHTAGPPPTPTAAGMPPPAKKQKRDHMELDPKNIYEVEAKILLATYPKLDLEPTKNAEETIAKLEKLAHPEHSHKPPEPKVRKRTVAEVAHDEALAAEQERYMLTLDERLSSKLAGAQAGANGADGDGQAPSASWEPRFERFKLIENIKQEHAEKKEQERIKQAEQERKLLQQKQEAAILQARQQQAEMERKRQEQIVLQQRQEAQRRLQQAQAAPVAQAQAQAQAQAQAQAQAQAQAQARAQARAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAAQAQAQAQAQAQAQAQAQAQAQAQAQAQQAATAATMGQTPHAHPMQPSPLPAGMTAGMPVSMAQQAQARFSQVSQPQQMSSPIVQQGTPQAASSPMPPMAAVAMQHSNSNMGQAGSPPRPPSVVQNHPMGVPMAPSMSARGSQQSHAAGTPRVPSATPNIPHATPITRPQVVPTPRMTQASPPAGVMTPTPQQMGQAMLMNNQGIAQMPNVNINSLAAAQQMAAQQRLIQQYQQQLQQSGMVPGNVQANMLQQQLAARQQMMIQQQLLAQQQQRAGQMMNPNIQAQLAAQYQQSLNNMQQQQLAQMNPMQAAHMRQLLAAQQAQRQGMMGVNVNVNGMTPQQLAVMQQQIQLQQQAQLIQQQQQQQQQLQQQQQQQQQQQQQQQQQQQQQQQQQAAQQQPQPGMPGHPPQAAVAPTAPQVPIAQLQPPQNQLAALMMNPAVQNQIRNHSNALYSKNLPALAERFGGNAQNIPPEALAEFRQKCLNQAKVQVLSMLQQQQAGGRLAAGLPPQVQAAQVQAMQQQAQALAVAQAQVQAAQQAAAAQAAQQQGGMGQGM

Entity 3 Entity 3 polymer

Description description	Uncharacterized protein
Molecular weight formula_weight	48541.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MALSDNNPEEVDGMFLSNLRSDLELEEIWRMLQSGVTSPEDSQPTVSLDASSSGDKTMSSESQVALQDDADDELLVSILAGKVPLSELLANDNELLQSDGLSSAVCSADSDQEEDDNNDAGYGEEPDPRDVIANWFELCQMMYVSGETGEPSLETTGIIEDIVRQQVIEIIRHDAPKVSRLRTFLAWKDVRKNVKDSDDKGADADIAPGDDPVGAVVPGATVDDTARKTKKSRVGLPWEPASFYSVEVPEREDEEDEEEEEMNYITLQRLRKADERTKAMTKEEYVTWSEFRQASFTYRKGKRFREWAGFGLVTDSKPSDDIIDILGFLTFEMVQTLTEEALKIKEQEDLHRERTGENQSNANNPNGSANSSLSKKRKLTGGGGLFDPPNEGRTPVEPRHIQEAFRRLQQRPKKARAMLNGTKLQQRTQLKLF

Entity 4 Entity 4 polymer

Description description	Transcription initiation factor TFIID subunit 5
Molecular weight formula_weight	83784.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSNPAPQAAGQGAAGTPYGNPPPSAGGAGSGSAGASAPSTTPSAQNLNQIVTDYLKKKGFTRTEAVFRQETAHLGPDGRPVNRNDDPGPKKYLKAFLLLKNWIDNNLDIYKFELRKLLWPVFVYSYLELVSQGYVDDAKHLLETLRSHFEAVHQDQLALLDTVTLPQHVSENHTTRLYRENKYRIPLNQSLSGNLFHFLEREADNGGATIIYILQTHCSVETSARGPIEPYSFEAIYRRARNLDLDEADAHEGIPGIFTGVTNRDVLDTSARLKLGPLPMEPELREDVRAELEEEDQRNPPMDNRPTLVEEFDKKIKREESADSPSRNDLPLPASRARDVVMEMQKVRENRDRFVIEGRTGGIGIPVSACMFTFHNTLGTVSCMDFSNDHKLVAVGTMDSYIRVWSLDGKPLKSALENEKNLKVNNRKLIGHSGPVYGVSFSDSIANLDRNIYGEGDDKKPDTSSKLLLSCSADGQIRLWSLEIWACLCIYKAHDGPVFRVLWGPHGHYFASAGWDKTVRVFTQDHASAVRIMVGHDTSISALAWHPNGTYVFSASDEMDKSIRMWSVITGNCVRIFTGHTHYITALECAHNGKILASADTGGNIFIWDIEKGTLIKKCRGHGKGGIPSLSFSAESNVLVSGGLDCTVRVWDIELPADPNKNNPLAPSTTQSGQQSDGTTATGDTIAVGGSADGRNITVGGQGTQAGGAGTSGSGVAGAVTGKKKAKEVQITPDQISAFATKKTPVLKVRFTRMNLIVAGGCYDPER

Entity 5 Entity 5 polymer

Description description	Transcription initiation factor TFIID subunit 6
Molecular weight formula_weight	52463.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MATNEGPKLLWNPENVRDVADALGITLSEEPLRLLAQDVEYRIGQVIVESLRFMRAANRTTLTVQDVSLALRVLDVEPLYGYESTRPLRYGEASLGPGQPLFYIDDEEVDFEKVINAPLPKVPRDMTFTAHWLAVEGVQPSIPQNPTTAETSSKDLLPKGPGANPALAALAGNDNVSFRPSVKHVISKELILYFDKIQAAILDDDPDEEKMRLRQAALESVRSDPGLHQLLPYFVNFITNQVTHHLDDLFILRQMMELAEAVVQNPTLFIDPYASALAAPVLTCLMSRKLGKNPSSNDEGALGAGNSIDSTLREQYSLRELAASLLSMIARKYGASNALLRPKLTRTCLKHFLDPTRPPAVLFGAISGVAASGGPEAVRVLVLPNLKTFDSAVLQPLREKAGPVAELEYEMLVGGIVKAVQSIVGDQAALGALTNGINGADLTREGEQVIEFLGPIVGQRIAQLRNHTLNRSILEVRHLE

Entity 6 Entity 6 polymer

Description description	Putative transcription initiation factor
Molecular weight formula_weight	28834.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSAATTAPQTNGILPSTTASGAQTISNTPQPSTSQPAPSATPAQSQTPATTQPQQPTSTTTPSPRPRDARTLELLLTAQGVTSFEPRVSQLLLDFAYRHTAAVLSDALHLSADPYISHAGARPSASSGAAPVNVGEASITANAVALAISSRLGYQFRGGGGGYYGGGGGGASKDWMLELARERNKVALPRVLPSEWGVRLPGERFVLSGVSWGLKDVWAGQEGESEEESEPEEQGDKMEVDENGKNGEAEDGVEVEGGTMEDVFGDEGLEDEEMGEA

Entity 7 Entity 7 polymer

Description description	Transcription initiation factor TFIID subunit 10
Molecular weight formula_weight	21417.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MATNQSIDNSVSQPAAPTASANGTSQPAGETTSMFPGIPSASVPEPKLPTRKDASLREFLNKMDDYAPIIPDAVTNYYMTRAGLPPPPQTDIRLARLLALATQKFIADIAADAYQYSRIRASNTNANNPMGSLGAAAGFPIPGQPSNQPGGKEQGRGGPLGIQRPGYGGGGQGGSQNRTVLTMEDLGMAVSEFGVNVKRSEFYR

Entity 8 Entity 8 polymer

Description description	Transcription initiation factor TFIID subunit 12
Molecular weight formula_weight	83091.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MNQTPAQGQGQGQPGQGMANRPPNAPSAANVAAPGGAPRQQGTPMYRPEMMRNIPLLSDEEKTKYERGLQQLWLMHDNTAPGSAENIEAKKKIAEFGRVLLTKLQQRRQQQQLQQQRQQQQQQQQQQQQQQQQQQQVQQQMQQQAQQPQTQPQQGQPQQQLQQAQVQQQVQQQQQIPQQQQQAPQQQQQQQQPQQLGQPGQQVQMMPQNQQPQVAQNVQPVAPTTVPQQQPAPATQTAPNQMGAPNSAAAQLRSLPAHIVSHVKDVTFLAPNNVVDKAGWIDQLKLQYAQKLFVMDSAGRQIKQIAASLADQSLPPEERKKLEEKKQTLEKQYNDAISFANTVRKQYMQKPAQNGAAVQNAANVARPQSAQGASAMTQPGAGVGNGTPVAAPVNPMQSSAAAINTAIETAKKQQMAAGRMAGAVNAMAAQVQSPATPVQAQVSPATQVHATQQSVPQQPQQIQQAQPTQQPQAQVKIEPGTAPHPAPLNTTMAGPTGVPSAAAPAQNAARMQTPTSATPTSANPNIRPLTHAAAMNLASQQRPGMPAVPTAASGAAPGTPMGIMGAAQQQQQQQPGHSHAHPPQPTQAPPPHSTNPKLPIPKVLHDKAIQMPQPVPNIGGAGSGRPTYTSGVMNQPALPKTPAFQLEGEGERVLNKKKLDELVRQVCGGTAEGQDGNMLTPEVEESVLNMADAFVDNVLHQACRNAKERGSKVLEIRDIQLVLERVYNIRIPGYASEELRTVRKVQPNSNWIKKMSAVQAAKVVPGKGDI

Entity 9 Entity 9 polymer

Description description	Putative transcriptional activator protein
Molecular weight formula_weight	131755.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSIANGNHPWPSPGGPFTNGGPPRTPSAALDARPHDASQTTSLSLMPEASSATDINSDDIDHRRALFADLFRRADERLNLLFDERGEYNLSAIESFKRPPSPPAPSLLPPVTDHTPIQEPPRKRAKRVIDEDDYGDDDEEDEDDKPVDKKPPQQTSQLSNNVLLSPSKTSESPAHSSPSPEKQALEKPPETSQQQLGQGQQQPKSTEDARKELEQARIATEEIAKRSFHTLFYTLEHDRTAMLEQQQLEESEKQLQAEMDKAGSGNAQQNQPGHGSLSSANLGASSLTLKHLIARIDQKRERVRASDAELRSLMNEVRKNRSKWASEENIGQEELYEALEKVLSELKAHTEYSTPFLQRVSKREAPDYYTFIKQPMDLGTMTKKLKSLQYKSKAEFVYDLNLIWDNCLKYNQDMNHPLRRMANGMRKEADKLIPLIPDITIRSRAEVEAEERRKQNGGVDDDAGDDSDDEPIMSSRGRVAGTKGTSNKSRKAPKEGTPAAGDQKPVVQVNGVQVKGQREGSEAVDGSNGLGTPPVGGSATPAPGLNGHGSSQNADAMDVDGPSINGMALVGEEAAEQTYEDEAYKIWKQVTKKDRALIAKERYQLFANNKLNVEEPALLRTKAGMRRFLKSRREAEALGLIKTAYSDSSVTSSAGAKDGVAPKPNETLAEGMEEEADRAVPSYYEPQTIIPDIDPKLQWVEDGEGQVINQFEDMLQLVPPGHFTAPSSRLTRRIDANIRQMQETRKLCSKIGVIKQMQIQTHPFVEADIEPHYISGEGPVMAGEVCRSALQRSVAKIFYHAGFEELQPSALDCITDIASDYFQKLVRTFNVYREAEKKPATGAAAERGARFVPRFTPEEVILHTLDENGHDIDSLEAYARDEVERLGNKLAQIHERMKGHLADLLRPALAPDAGADGSGAFNDGSEQFVTGDFAEELGEDFFGFRALGLDKELGLDMLSVPLHLLQSRVRSQYQLQNQAGAGSAAADLFEPLPPPEPVTKESIMNEIGLVRNFFLAKLHASGDKPLVEDEDLPPKQRKARPRLGATGKIVSPQKRSPKEQMALAKKKKKLEQQQQQQQAQQQEQGKGDNKKGAAKTVSLSLPQPAAGQQVNGLTLPSLSAPNPSSQGGEVNGESIVVNTSLSDTQQSGDVTTTQGEKDLEMEMEMELEKAAGDEDGMDDGDMVFEAGMMSPESLER

Entity 10 Entity 10 polymer

Description description	SCA7 domain-containing protein
Molecular weight formula_weight	137082.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MDSRKDEEATIKVAPAKGTVLASKPHIWGKLKLKKPPVKQIKPGNWKEATLVEDKKKDKDGGAINAASPGPDVNQLDDRARDTFSNGRPLEDVLELLQCKLCRKGISRTAARDHIAKCLQIKKEKAQRKKEAREARERLKEAAREEEARRLEEEGAAKGDDDSDDDDGKEGAGKAGKKTKKTDVAGKKRKAEGELDKGKAKKKKDEPKPKVAKPKGPVDVERQCGVPLPNGQLCARSLTCKSHSMSAKRAVPGRSLPYDMLLAAYQKKNQAKQQKAALDANAPLEDEDDLNAGAVDSDEETAAVMSALANWNPQPVVPQPVFAPLKRQYQLARLHEQLQAATNGGRTNIFKVVGFGAQRLSDGHLGLYDAEDAPGEPDPVGLGSLSRRSSSIVAGEDDTTQQAQIAAVDHESQKEDAPLAEVCKKPCWKPKDRPGSVLDQEYVPMSGRSLSKVTKLKATGRAAANRQPKQSRRAASAIPESSKPLADAPVNTIVSKSSPALPTATPLYAFANLPTTDLRLQPAELAIQEMRKRLIAASSSSQSSISSTGVRAPRGRKRKEDRSMPGIHGSQPMENIHRATDGVRQTPENMAPTPKESPSDSTVEMRVLELGQLLAQEDSLAKSSPVLPNTPVVSLLGTSQNGATNGLKQGVQHIQRQMATKPTSVSRAISHSPMSSRPLFSAPSPPMMSHSLSPLTRAATPKALSSSPLVMSMLLPQQPPSHPFVSLPSGSTLSQAMQQSPIMTSMSKSGLTPAATRQPSPGVMPHSPPPRQGPGRPPKPRPADPVSPVNPTRSPNLPNASYLTTLGDLSTGMQPPQLPHMPQQQVPRVKLNQMRNQALASTFSPRPSYLPSQRLDPIREQAIKRAAERAAGLRMAQAQRQPQMQVHMNVQAQRTPQLQARTSPPTASPAETQGQMLSARAQAEDQGQNRLRMGQPQANTQLMRIDGPGMAAGMRQPIGNSQMDTMQPQRQVMNTPVVPAPQSSSPPSAERSSSQPQPVRDQIDSASVQAEAAQDETMNLDNDEMDDILREVKAQAEREAERQMAALSRTRPQAQQQAQNLRSTQNQSQMHALSPVASESSSPSLVMSASLPGLNEVNVRATVAAAAKKVAGSISPVANISSAATALSSPLDCRPYTTTSIPRPRLATTAPVPLMGATGPPAASGTTQNIGSFHVQQHRQRRQQQQLLQQHAQQHQQRLQQAAVHNNQQPFRFTYPAESMAAAVAIAGAHNLRPVVPLPPQAYLLSASQGGGRSGSRGSNIRNGSQARTQEQG

Entity 11 Entity 11 polymer

Description description	Putative transcriptional coactivator HFI1 protein
Molecular weight formula_weight	52133.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MVDINPAALSRPSIGLSTPSFPGKSGSINVSVPSSASASASASSAHSKPQKTSLVPPRIDLEPIYTALKAAIGAEQWPVYKETLTNFLIGRLNQAELSERIDPILASQDGQKEHLHNQLIAAIYANVTREMPDPGLAPWVSANDKPTTAQTKPVTGDANERRLKGEVMQLPARDRRRIKELAHNDFDPYDALANVLMEHARAKPPKIAEPPASAGGLKMNFDLEIRKRYAQPLAVESGEFPDTSNIESRMLPFCYEAGLSSGHAPDAAQFMSIATETFIKEVMSAIFSRTRSNGPGDSGSAGFGLGSGWIQTHRYRKQLAKEEEAFQRGEISRDKMGLLPVEAKAASERGPLGMADVRLALEMGDCGLAGFPVIVKSVIYGWREGELENWEDYTYVDPSRPDGIAIPSRGDGDVEMGGVGVNGVVKGEPEPQQQPLANGVHDVDAMDIDGVSVAGGAANEIWWEGAEPETSDLLNAVLDSCLAVN

Entity 12 Entity 12 polymer

Description description	Transcriptional adapter 2
Molecular weight formula_weight	58866.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MGVIRKKIAGRSGEGGVKYICDVCSVDITSTVRIRCADPACHDYDLCVPCFANGSSSNAHKPATHSFRVIEQNSFPIFDPDWGADEELLLLEGAEIYGLGSWADIADHIGGYRTKDEVRDHYLKVYIESPNFPLPERCSPYDLELPNSISREEFQARKKRRIEERREAAKNAPPPQPKTKPTASIPACHEIQGYMPGRLEFETEYCNEAEEAVQLMSFDPGDGINPRTGELEPEMELKLTVMEIYNNRLTQRVERKKVIFEHNLLEYRENTKAEKKRSREERELLNKAKPFARMMNRHDFEQFCQGLIDELNLRQAIAQLQEWRSMRIGDLKSGEKYEQEKALRIQKSMPMGSLDRERLATSQRGKNQQQPEPPSGAALLVAPELPARYKEPIIDANGFPRPDANRLTVDGGSVVVANGTSQPKPKYVPPPVPGVQPMNLTQDNAPDLHLLTPEEIKLCETLRIQPKPYIMIKEQILKEAVKGNGSLKKKQAKEICRLDSQKGGRIFDFMVNAGWVVKA

Entity 13 Entity 13 polymer

Description description	histone acetyltransferase
Molecular weight formula_weight	46983.7 kDa
EC 编号 ec_number	2.3.1.48
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MTSENGKRKATEEPGSPSAAKRIKQEPSETDKDKKEENKDKKTVAKPPPIPYPEKPAVIEERNGEIEFRVVNNDGERESLIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKKPLEVVGGITYRPFKNRKFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATTNIEHFLTYADNYAIGYFKKQGFTKEITLDKSVWMGYIKDYEGGTIMQCTMIPRIRYLEQGRMLLKQKECVQAKIRAFSKSHIVHPPPKQWRNGNVTPIDPLSIDAIRESGWSPDMDELARQPRHGPNYNQLLHLLNDMQNHASSWPFLVPVNKDEVVDYYDIIKEPMDLSTMESKLEADQYQTPEDFIRDAKLIFDNCRKYNNENTPYAKSANKLEKFMWQQIRQIPEWSHLEPS

Entity 14 Entity 14 polymer

Description description	Uncharacterized protein
Molecular weight formula_weight	79972.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MAPSSSQKGTGKKAGSAASAIRSHQQHSQQQRSRNTTPGPAGIPPTSSTSVSVSVASLPPIETVETETLDLRFDTFRNVTFEDLVDPAAASALIPDSKSLDGIISRLQRLADIIEKRGANCDRGMRLLAQTRRQRLDELAVERGREEERRQAEADDEKKANKKKRKADSLAPGAVNTERSSPNRESTSKARKLDRDDTASSSLSPAAAGTPSNMDVDDKDKEKDKDKTKAEADSDSDSDDGAPPPPPRPPANVFGDDPSTFPDPTVYEIRPVLPGMSEEEIKEIYSVASYPKSDLAHLTCGEPPDRDFSNSKPTNQINFSTFSSYIEPYFRPFTEEDLAFLRERGDRVTPFIMPKRGKKHYTEIWAEEDGAMAIDSSPPGGRDRLPPNQARGSIDNMDDEVAETDKLSVGPLLTRLLQAMRPENRAPTADDKSGPNGTSGDGDGPQQSFDFNDSTAAPNPSQSQPNGVNGVAATTNGDSQQQQQQQQHQSLPPATFMPESNTEAWKKATHPKLDYNQVDERIKQELRHIGFLPLPPSSATDPSNSSASVTPAAPPPPGTTATTAEYDGHYDDEVAARLRVLQARLREQILLNGARKARLTELVKERMAYQEYQTILEDLDAQVNAAYLKRTRTMGKKPKKNRPGQHSSGSAAAAAAAAAGMARPGIGDLARTLMDRRRRWIEQIGAVFDDEGITKCPRVEDGDTSIFGREIMAELIKREKEAWDEEVEEE

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.50 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	3566416

fit	/app/data/saxs_computation/yn/9ynw/9ynw.fit
pddf	/app/data/pr_computation/yn/9ynw/9ynw.pr.out
profile	/app/data/saxs_computation/yn/9ynw/9ynw.dat

Tra1, Core and minimal HAT modules of ctSAGA, composite.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Non-specific serine/threonine protein kinase

State in the Current Structure

Other States of the Same Protein in the Database

Spt20-like SEP domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Transcription initiation factor TFIID subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Transcription initiation factor TFIID subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Transcription initiation factor TFIID subunit 10

State in the Current Structure

Other States of the Same Protein in the Database

Transcription initiation factor TFIID subunit 12

State in the Current Structure

Other States of the Same Protein in the Database

Putative transcriptional activator protein

State in the Current Structure

Other States of the Same Protein in the Database

SCA7 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Putative transcriptional coactivator HFI1 protein

State in the Current Structure

Other States of the Same Protein in the Database

Transcriptional adapter 2

State in the Current Structure

Other States of the Same Protein in the Database

histone acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer

Entity 14 Entity 14 polymer

Polymer Polymer

8. Citations (1)