9z6v

The structure of TMD with 3 TARPs and 1 CNIH from all native AMPA receptor subtypes

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glutamate receptor 2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Mix of AMPAR subunit (GluA1, GluA2, GluA3 and GluA4) × 2 Mix of protein cornichon homolog 2 and 3 × 1 Mix of voltage-dependent calcium channel gamma subunits × 1 Voltage-dependent calcium channel gamma-8 subunit × 2 （Q8VHW2） (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 23 TETRADECANE × 3 6-[2-chloro-6-(trifluoromethoxy)phenyl]-1H-benzimidazol-2-ol × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GRIA2_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–37； UniProt 532–568 Author chain B； PDBConstruct 59–120； UniProt 590–651 Author chain B； PDBConstruct 274–310； UniProt 805–841 Author chain D； PDBConstruct 1–37； UniProt 532–568 Author chain D； PDBConstruct 59–120； UniProt 590–651 Author chain D； PDBConstruct 274–310； UniProt 805–841

Voltage-dependent calcium channel gamma-8 subunit

OrganismNot specified

UniProt Q8VHW2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	Mix of AMPAR subunit (GluA1, GluA2, GluA3 and GluA4) × 2 Glutamate receptor 2 × 2 （P23819） Mix of protein cornichon homolog 2 and 3 × 1 Mix of voltage-dependent calcium channel gamma subunits × 1 (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 23 TETRADECANE × 3 6-[2-chloro-6-(trifluoromethoxy)phenyl]-1H-benzimidazol-2-ol × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CCG8_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–422； UniProt 2–423 Author chain H； PDBConstruct 1–422； UniProt 2–423

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9z6v
Deposition date deposition_date	2025-11-14
Structure title title	The structure of TMD with 3 TARPs and 1 CNIH from all native AMPA receptor subtypes
Keywords keywords	Ionotropic glutamate receptor AMPA receptor, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9z6v__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9z6v__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9z6v__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.67 Å
Rg (electron density)	33.36 Å
Total Rg	34.00 Å
Atom count	8797
Residues	1138
Excluded volume	161590 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9z6v__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Mix of AMPAR subunit (GluA1, GluA2, GluA3 and GluA4)
Molecular weight formula_weight	29723.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	8797

KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSXXXXXXXXXXXXXXXXXXXXXNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSALSLSNVAGVFYILAGGLGLAMAVALIEFCYKSRA

Entity 2 Entity 2 polymer

Description description	Glutamate receptor 2
Molecular weight formula_weight	29838.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSXXXXXXXXXXXXXXXXXXXXXNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRA

Entity 3 Entity 3 polymer

Description description	Mix of protein cornichon homolog 2 and 3
Molecular weight formula_weight	17901.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

AFTFAAFCYMLALVLCAALIFFAIWHIIAFDELRTDFKAPIDQANPAAARERLANIERICALLRKLVAPEYSIHALFCAMFLCAAEWATLGLNAPLLFYHAWRYFHAPADASEAAYDAAAAMNADALAYCQKEAWCKLAFYLLSFFYYLYAMAYTLVSA

Entity 4 Entity 4 polymer

Description description	Mix of voltage-dependent calcium channel gamma subunits
Molecular weight formula_weight	21045.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

VQALLTTAGAFAAFALMTIAAATDYWLYARAAACATAAAAXXXXXXXXXXXAAAAKKAAAAATHSGLWRACCLEGAAAGACAAIAHFPEDADYAADAAEYALRAVRASSIFPILSAILLAAGGACAAASAAYKAAANIILAAGIAFVAAGLSNIIGAIVYISANAGAPAAAAAAAKKNAYSYGWSFYFGALSFIAAEAAGVLAVAAAIARAAAAAAAARAA

Entity 5 Entity 5 polymer

Description description	Voltage-dependent calcium channel gamma-8 subunit
Molecular weight formula_weight	43371.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H

ESLKRWNEERGLWCEKGVQVLLTTIGAFSAFGLMTIAISTDYWLYTRALICNTTNLTAGDDGPPHRGGSGSSEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEYLLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVYISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRSDLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRGSSEASPSRDASPGGPGGPGFASTDISMYTLSRDPSKGSVAAGLASAGGGGSGAGVGAYGGAAGAAGGGGAGSERDRGSSAGFLTLHNAFPKEAASGVTVTVTGPPAAPAPAPAPPAPAAPAPGTLSKEAAASNTNTLNRKTTPV

Entity 6 Entity 6 non-polymer

Description description	(2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate
Molecular weight formula_weight	760.1 kDa
Source method src_method	syn
Copy count entity_count	23

Entity 7 Entity 7 non-polymer

Description description	TETRADECANE
Molecular weight formula_weight	198.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 8 Entity 8 non-polymer

Description description	6-[2-chloro-6-(trifluoromethoxy)phenyl]-1H-benzimidazol-2-ol
Molecular weight formula_weight	328.7 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	82389

The structure of TMD with 3 TARPs and 1 CNIH from all native AMPA receptor subtypes

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glutamate receptor 2

State in the Current Structure

Other States of the Same Protein in the Database

Voltage-dependent calcium channel gamma-8 subunit

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9z6v__assembly_1__model_1

9z6v__assembly_1__model_1 | I(q)

9z6v__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)

The structure of TMD with 3 TARPs and 1 CNIH from all native AMPA receptor subtypes

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glutamate receptor 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Voltage-dependent calcium channel gamma-8 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9z6v__assembly_1__model_1

9z6v__assembly_1__model_1 | I(q)

9z6v__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)