← Back to search

9zpt

Cryo-EM structure of KCa3.1_II/calmodulin channel in complex with SKA31.

Method: ELECTRON MICROSCOPY D_max: 126.8 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9zpt
deposition_date	2025-12-17
title	Cryo-EM structure of KCa3.1_II/calmodulin channel in complex with SKA31.
keywords	;Intermediate conductance calcium-activated potassium channel, Ion channel, Calmodulin binding protein, TRANSPORT PROTEIN, MEMBRANE PROTEIN ;; MEMBRANE PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	43.31 Å
rg_electron	41.99 Å
i0	418082000.00
molecular_weight	170710.0 kDa
excluded_volume	215650 Å³
envelope_volume	348100 Å³
shell_volume	69058 Å³
envelope_diameter	130.2 Å
shell_rg	47.66 Å
envelope_rg	40.75 Å
shape_rg	42.07 Å
total_rg	42.06 Å
total_atoms	12016
n_residues	1628
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	126.8 Å
rg_real	43.03 Å
rg_real_error	0.60 Å
i0_real	4.1810e+08
i0_real_error	6.2220e+06
rg_reciprocal	43.31 Å
i0_reciprocal	418200000.0000
total_estimate	0.8685
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	56.4 Å
skewness	0.047
kurtosis	-0.475
angular_range	— – 0.1800 Å⁻¹
current_alpha	0.0000
highest_alpha	34370000.0000
n_real_points	37
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.943; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.968; Smooth: 0.491

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Intermediate conductance calcium-activated potassium channel protein 4
formula_weight	38402.8 kDa
src_method	man
entity_count	4

Polymer

type	polypeptide(L)
strand_id	A,B,C,D
atom_count	12016

LGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPVRPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVN

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Homo sapiens

Entity 2 polymer

description	Calmodulin-1
formula_weight	7695.4 kDa
src_method	man
entity_count	4

Polymer

type	polypeptide(L)
strand_id	E,F,G,H

SEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Homo sapiens

Entity 3 non-polymer

description	POTASSIUM ION
formula_weight	39.1 kDa
src_method	syn
entity_count	4

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	3.390 Å
resolution_low	— Å
r_factor	—
r_work	—
r_free	—

resolution	3.39 Å
resolution_method	—
num_particles	107638

fit	/app/data/saxs_computation/zp/9zpt/9zpt.fit
pddf	/app/data/pr_computation/zp/9zpt/9zpt.pr.out
profile	/app/data/saxs_computation/zp/9zpt/9zpt.dat

Cryo-EM structure of KCa3.1_II/calmodulin channel in complex with SKA31.

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

EM 3D

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)