SAXSdb — 9zvu

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	L(+)-TARTARIC ACID × 4 SODIUM ION × 4 SULFATE ION × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	L(+)-TARTARIC ACID × 3 SODIUM ION × 4 SULFATE ION × 2 D(-)-TARTARIC ACID × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ETV6_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 13–88； UniProt 47–122 Author chain B； PDBConstruct 13–88； UniProt 47–122

Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1

Homo sapiens

UniProt Q13470

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	L(+)-TARTARIC ACID × 4 SODIUM ION × 4 SULFATE ION × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	L(+)-TARTARIC ACID × 3 SODIUM ION × 4 SULFATE ION × 2 D(-)-TARTARIC ACID × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TNK1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 89–165； UniProt 590–666 Author chain B； PDBConstruct 89–165； UniProt 590–666

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9zvu
Deposition date deposition_date	2025-12-30
Last revision last_revision	2026-03-04
Structure title title	The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone, alternate crystal form
Keywords keywords	;Sterile Alpha Motif (SAM) of Human Translocation ETS Leukemia (TEL), protein crystallization chaperone, TELSAM, ETV6, TRANSCRIPTION, 1TEL Crystallization Chaperone, ONCOPROTEIN, TNK1, UBA, Ubiquitin-Associated Domain, Thirty-eight Negative Kinase-1 ;; ONCOPROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9zvu__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9zvu__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9zvu__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.19 Å
Rg (electron density)	20.83 Å
Total Rg	21.46 Å
Atom count	2246
Residues	153
Excluded volume	20770 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9zvu__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9zvu__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1
Molecular weight formula_weight	19304.7 kDa
EC 编号 ec_number	2.7.10.2
Mutation mutation	R80S,L96E,V112E,L591V,C610A,C644A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4656

MGHHHHHHHHHHSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLELTKEDFRYRSPHSGDELYELLQHILKEVQRKIMEVELSVHGVTHQEAQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADAWRILEHYQWDLSAASRYVLARP

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	L(+)-TARTARIC ACID
Molecular weight formula_weight	150.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 3 Entity 3 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	nat
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	D(-)-TARTARIC ACID
Molecular weight formula_weight	150.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	121

▶

Unit-cell length a length_a	38.213 Å
Unit-cell length b length_b	79.367 Å
Unit-cell length c length_c	119.173 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	1.964 Å
Low-resolution limit resolution_low	59.590 Å
R factor r_factor	0.2127
R_work r_work	0.2110
R_free r_free	0.2469

The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone, alternate crystal form

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1

State in the Current Structure

Other States of the Same Protein in the Database

Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9zvu__assembly_1__model_1

9zvu__assembly_1__model_1 | I(q)

9zvu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone, alternate crystal form

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9zvu__assembly_1__model_1

9zvu__assembly_1__model_1 | I(q)

9zvu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)