9zvu

The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone, alternate crystal form

Method: X-RAY DIFFRACTION D_max: 73.1 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 47–122	Fragment：TNK1 UBA domain,TNK1 UBA domain Mutation：R80S,L96E,V112E,L591V,C610A,C644A	TLA L(+)-TARTARIC ACID × 4 NA SODIUM ION × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M Sodium Tartrate, 16% PEG 3350 Monodisperse	Resolution 1.96 Å R-free 0.247
2	Insufficient information Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 47–122	Fragment：TNK1 UBA domain,TNK1 UBA domain Mutation：R80S,L96E,V112E,L591V,C610A,C644A	TLA L(+)-TARTARIC ACID × 3 NA SODIUM ION × 4 SO4 SULFATE ION × 2 TAR D(-)-TARTARIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M Sodium Tartrate, 16% PEG 3350 Monodisperse	Resolution 1.96 Å R-free 0.247

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9ZVU	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1JI7 Crystal Structure of TEL SAM Polymer Deposited 2001-06-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 47–123（77 aa） Fragment：TEL SAM domain Chain B 47–123（77 aa） Fragment：TEL SAM domain Chain C 47–123（77 aa） Fragment：TEL SAM domain	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；Li2SO4, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.45 Å R-free 0.195
1LKY Structure of the wild-type TEL-SAM polymer Deposited 2002-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 47–123（77 aa） Fragment：Pointed domain Chain B 47–123（77 aa） Fragment：Pointed domain Chain C 47–123（77 aa） Fragment：Pointed domain Chain D 47–123（77 aa） Fragment：Pointed domain Chain E 47–123（77 aa） Fragment：Pointed domain Chain F 47–123（77 aa） Fragment：Pointed domain	Mutation：V80R Mutation：A61D Mutation：V80R Mutation：A61D Mutation：V80R Mutation：A61D	SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；5% PEG 4000 2.0 M ammonium sulfate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.30 Å R-free 0.283
1LKY Structure of the wild-type TEL-SAM polymer Deposited 2002-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 47–123（77 aa） Fragment：Pointed domain Chain B 47–123（77 aa） Fragment：Pointed domain Chain C 47–123（77 aa） Fragment：Pointed domain Chain D 47–123（77 aa） Fragment：Pointed domain Chain E 47–123（77 aa） Fragment：Pointed domain Chain F 47–123（77 aa） Fragment：Pointed domain	Mutation：V80R Mutation：A61D Mutation：V80R Mutation：A61D Mutation：V80R Mutation：A61D	SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；5% PEG 4000 2.0 M ammonium sulfate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.30 Å R-free 0.283
1LKY Structure of the wild-type TEL-SAM polymer Deposited 2002-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 47–123（77 aa） Fragment：Pointed domain Chain B 47–123（77 aa） Fragment：Pointed domain Chain C 47–123（77 aa） Fragment：Pointed domain Chain D 47–123（77 aa） Fragment：Pointed domain Chain E 47–123（77 aa） Fragment：Pointed domain Chain F 47–123（77 aa） Fragment：Pointed domain	Mutation：V80R Mutation：A61D Mutation：V80R Mutation：A61D Mutation：V80R Mutation：A61D	SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；5% PEG 4000 2.0 M ammonium sulfate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.30 Å R-free 0.283
1LKY Structure of the wild-type TEL-SAM polymer Deposited 2002-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 47–123（77 aa） Fragment：Pointed domain Chain B 47–123（77 aa） Fragment：Pointed domain Chain C 47–123（77 aa） Fragment：Pointed domain Chain D 47–123（77 aa） Fragment：Pointed domain Chain E 47–123（77 aa） Fragment：Pointed domain Chain F 47–123（77 aa） Fragment：Pointed domain	Mutation：V80R Mutation：A61D Mutation：V80R Mutation：A61D Mutation：V80R Mutation：A61D	SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；5% PEG 4000 2.0 M ammonium sulfate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.30 Å R-free 0.283
1LKY Structure of the wild-type TEL-SAM polymer Deposited 2002-04-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 47–123（77 aa） Fragment：Pointed domain Chain B 47–123（77 aa） Fragment：Pointed domain Chain C 47–123（77 aa） Fragment：Pointed domain Chain D 47–123（77 aa） Fragment：Pointed domain Chain E 47–123（77 aa） Fragment：Pointed domain Chain F 47–123（77 aa） Fragment：Pointed domain	Mutation：V80R Mutation：A61D Mutation：V80R Mutation：A61D Mutation：V80R Mutation：A61D	SO4 SULFATE ION × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；5% PEG 4000 2.0 M ammonium sulfate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.30 Å R-free 0.283
2DAO Solution structure of ETS domain Transcriptional factor ETV6 protein Deposited 2005-12-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 338–442（105 aa） Fragment：ETS domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；296 K；Ionic strength (raw mmCIF value) 120；Pressure ambient NMR sample composition 1.19mM ETS domain U-15N, 13C; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90%H2O, 10%D2O \| 90% H2O/10% D2O	Resolution not provided
2QB0 Structure of the 2TEL crystallization module fused to T4 lysozyme with an Ala-Gly-Pro linker. Deposited 2007-06-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 47–123（77 aa） Chain D 47–123（77 aa）	Mutation：E80V	MN MANGANESE (II) ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.56 Å R-free 0.252
2QB0 Structure of the 2TEL crystallization module fused to T4 lysozyme with an Ala-Gly-Pro linker. Deposited 2007-06-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 47–123（77 aa） Chain C 47–123（77 aa）	Mutation：E80V	MN MANGANESE (II) ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.56 Å R-free 0.252
5L0P Symmetry-based assembly of a two-dimensional protein lattice Deposited 2016-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 47–124（78 aa） Fragment：3 x TelSAM (UNP residues 47-124) + FUR (UNP residues 3-83) with connecting linkers	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；290 K；100 mM Tris, pH 8.0, 3.5 M sodium chloride	Resolution 2.30 Å R-free 0.236
7JU2 Crystal structure of the monomeric ETV6 PNT domain Deposited 2020-08-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 43–125（83 aa） Fragment：PNT domain	Mutation：A93D,V112E	FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298.15 K；2.8 M Sodium Acetate	Resolution 1.85 Å R-free 0.234
7JU2 Crystal structure of the monomeric ETV6 PNT domain Deposited 2020-08-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 43–125（83 aa） Fragment：PNT domain	Mutation：A93D,V112E	FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298.15 K；2.8 M Sodium Acetate	Resolution 1.85 Å R-free 0.234
7N1O The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone Deposited 2021-05-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 46–123（78 aa）	Mutation：1TEL: R41A,D46G,V112E,K122A,vWa: R49A,C175A,V112A,K112A	MG MAGNESIUM ION × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.7；298 K；100 mM BisTris, 3.0 M NaCl	Resolution 2.77 Å R-free 0.228
7N2B A DARPin semi-rigidly fused to the 3TEL crystallization chaperone Deposited 2021-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–121（75 aa） Chain A 47–124（78 aa）	Mutation：V67E Mutation：V67E	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；298 K；200 mM L-Proline, 100 mM HEPES, 10 % w/v Polyethylene glycol 3350	Resolution 3.22 Å R-free 0.242
7N2B A DARPin semi-rigidly fused to the 3TEL crystallization chaperone Deposited 2021-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–121（75 aa） Chain B 47–124（78 aa）	Mutation：V67E Mutation：V67E	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；298 K；200 mM L-Proline, 100 mM HEPES, 10 % w/v Polyethylene glycol 3350	Resolution 3.22 Å R-free 0.242
7T8J The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused to the 1TEL crystallization chaperone via a GSGG linker Deposited 2021-12-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–121（75 aa）	Mutation：R80S,V112E,C610A,C644A	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；1.2 uL of 1 mg/mL protein in 50 mM Tris pH 8.8, 200 mM KCl combined with 1.2 uL of 100 mM Bis-tris-propane, 2.5 M Ammonium Nitrate	Resolution 1.89 Å R-free 0.235
7TDY The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused to the 1TEL crystallization chaperone via a 2-glycine linker and crystallized at low protein concentration Deposited 2022-01-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–120（74 aa）	Mutation：R80S,V112E,C610A,C644A	FMT FORMIC ACID × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；1.2 uL of 2 mg/mL protein combined with 1.2 uL of 100 mM Bis-Tris, pH 7.00, 250 mM Mg-Formate.	Resolution 1.53 Å R-free 0.217
7TW7 Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM Deposited 2022-02-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–123（77 aa）	Mutation：A4R, E67V, A77K	ZN ZINC ION × 1 SAM S-ADENOSYLMETHIONINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293.15 K；11-17% Reagent Alcohol, 0.1-0.3M Lithium Sulfate, and 0.1M Sodium Citrate pH 5.5	Resolution 1.62 Å R-free 0.218
7TW8 Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH Deposited 2022-02-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–123（77 aa）	Mutation：A4R, E67V, A77K	SAH S-ADENOSYL-L-HOMOCYSTEINE × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293.15 K；11-17% Reagent Alcohol, 0.1-0.3M Lithium Sulfate and 0.1M Sodium Citrate pH 5.5	Resolution 1.55 Å R-free 0.206
7TW9 Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin Deposited 2022-02-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–123（77 aa）	Mutation：A4R, E67V, A77K	SFG SINEFUNGIN × 1 ZN ZINC ION × 1 PEG DI(HYDROXYETHYL)ETHER × 1 EOH ETHANOL × 1 MOH METHANOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293.15 K；11-17% Reagent Alcohol, 0.1-0.3M Lithium Sulfate, and 0.1M Sodium Citrate pH 5.5	Resolution 1.41 Å R-free 0.232
7U4W The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused to the 1TEL crystallization chaperone via a 2-glycine linker and crystallized at traditional protein concentration Deposited 2022-03-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–121（75 aa）	Mutation：R80S,V112E,C610A,C644A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；1.2 uL of 15 mg/mL protein combined with 1.2 uL of 100 mM Bis-Tris, pH 6.50, 750 mM Mg-Formate	Resolution 2.10 Å R-free 0.276
7U4Z The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused to the 1TEL crystallization chaperone via a 2-glycine linker and crystallized at very low protein concentration Deposited 2022-03-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–121（75 aa）	Mutation：R80S,V112E,C610A,C644A	K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；1.2 uL of 0.5 mg/mL protein combined with 1.2 uL of 100 mM Bis-Tris, pH 6.00, 630-750 mM Mg-Formate.	Resolution 2.03 Å R-free 0.232
8BWU Crystal structure of SARS-CoV-2 nsp14 methyltransferase domain in complex with the SS148 inhibitor Deposited 2022-12-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–123（77 aa）	Not recorded	6NR (2~{S})-2-azanyl-4-[[(2~{S},3~{S},4~{R},5~{R})-5-(4-azanyl-5-cyano-pyrrolo[2,3-d]pyrimidin-7-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methylsulfanyl]butanoic acid × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；100 mM bicine/Trizma pH 8.5; 10% w/v PEG 20.000, 20% v/v PEG MME 550; 20 mM D-glucose, 20 mM D-mannose, 20 mM D-galactose, 20 mM L-fucose, 20 mM D-xylose, 20 mM N-acetyl-D-glucosamine	Resolution 2.36 Å R-free 0.264
8E1F Sterile Alpha Motif Domain of Human Translocation ETS Leukemia, Non-Polymer Crystal Form Deposited 2022-08-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–124（78 aa） Fragment：Sterile Alpha Motif Domain, residues 47-126	Mutation：R35S, V67E	CL CHLORIDE ION × 1 SO4 SULFATE ION × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；298 K；200mM MgSO4 Heptahydrate, 20% w/v Polyethylene Glycol 3,350	Resolution 2.16 Å R-free 0.229
8E1F Sterile Alpha Motif Domain of Human Translocation ETS Leukemia, Non-Polymer Crystal Form Deposited 2022-08-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–124（78 aa） Fragment：Sterile Alpha Motif Domain, residues 47-126	Mutation：R35S, V67E	CL CHLORIDE ION × 1 SO4 SULFATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；298 K；200mM MgSO4 Heptahydrate, 20% w/v Polyethylene Glycol 3,350	Resolution 2.16 Å R-free 0.229
8E1F Sterile Alpha Motif Domain of Human Translocation ETS Leukemia, Non-Polymer Crystal Form Deposited 2022-08-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 47–124（78 aa） Fragment：Sterile Alpha Motif Domain, residues 47-126	Mutation：R35S, V67E	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；298 K；200mM MgSO4 Heptahydrate, 20% w/v Polyethylene Glycol 3,350	Resolution 2.16 Å R-free 0.229
8E1F Sterile Alpha Motif Domain of Human Translocation ETS Leukemia, Non-Polymer Crystal Form Deposited 2022-08-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 47–124（78 aa） Fragment：Sterile Alpha Motif Domain, residues 47-126	Mutation：R35S, V67E	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.9；298 K；200mM MgSO4 Heptahydrate, 20% w/v Polyethylene Glycol 3,350	Resolution 2.16 Å R-free 0.229
8FRJ Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946 Deposited 2023-01-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–123（77 aa）	Mutation：A4R, E67V, A77K	ZN ZINC ION × 1 AW2 5-bromo-7-{5-[(3-{[(4-tert-butylphenyl)carbamoyl]amino}propyl)(propan-2-yl)amino]-5-deoxy-beta-D-ribofuranosyl}-7H-pyrrolo[2,3-d]pyrimidin-4-amine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293.15 K；11-17% Reagent Alcohol, 0.1-0.3M Lithium Sulfate and 0.1M Sodium Citrate pH 5.5	Resolution 1.57 Å R-free 0.204
8FRK Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158 Deposited 2023-01-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–123（77 aa）	Mutation：A4R,E67V,A77K	ZN ZINC ION × 1 EOH ETHANOL × 1 MJ7 5'-S-(4-{[(4'-chloro[1,1'-biphenyl]-3-yl)methyl]amino}butyl)-5'-thioadenosine × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293.15 K；11-17% Reagent Alcohol, 0.1-0.3M Lithium Sulfate and 0.1M Sodium Citrate pH 5.5	Resolution 1.61 Å R-free 0.251
8FT6 The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, SUMO tag-free preparation. Deposited 2023-01-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–124（78 aa）	Mutation：R14A,V77E,K87A,R89A,R91A,A225V	CIT CITRIC ACID × 1 IOD IODIDE ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M Ammonium citrate tribasic, 20% w/v PEG 3350	Resolution 2.62 Å R-free 0.234
8FT8 The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, SUMO tag-free preparation Deposited 2023-01-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–124（78 aa）	Mutation：R14A,V77E,K87A,R89A,R91T,A92V,A225V	GOL GLYCEROL × 1 CL CHLORIDE ION × 3 K POTASSIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES, 2.0M ammonium sulfate	Resolution 1.60 Å R-free 0.204
8FZ3 Sterile Alpha Motif of Human Translocation ETS Leukemia, Non-Polymer Crystal Form Deposited 2023-01-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–123（77 aa）	Mutation：R45S, V77E	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.2；298 K；1.4 M Sodium phosphate monobasic monohydrate/Potassium phosphate dibasic pH 8.2	Resolution 2.78 Å R-free 0.267
8FZ3 Sterile Alpha Motif of Human Translocation ETS Leukemia, Non-Polymer Crystal Form Deposited 2023-01-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–123（77 aa）	Mutation：R45S, V77E	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.2；298 K；1.4 M Sodium phosphate monobasic monohydrate/Potassium phosphate dibasic pH 8.2	Resolution 2.78 Å R-free 0.267
8FZ3 Sterile Alpha Motif of Human Translocation ETS Leukemia, Non-Polymer Crystal Form Deposited 2023-01-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 47–123（77 aa）	Mutation：R45S, V77E	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.2；298 K；1.4 M Sodium phosphate monobasic monohydrate/Potassium phosphate dibasic pH 8.2	Resolution 2.78 Å R-free 0.267
8FZ3 Sterile Alpha Motif of Human Translocation ETS Leukemia, Non-Polymer Crystal Form Deposited 2023-01-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain D 47–123（77 aa）	Mutation：R45S, V77E	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.2；298 K；1.4 M Sodium phosphate monobasic monohydrate/Potassium phosphate dibasic pH 8.2	Resolution 2.78 Å R-free 0.267
8FZU The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, Expressed with SUMO tag Deposited 2023-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–111（65 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES 2.0M ammonium sulfate	Resolution 1.90 Å R-free 0.266
8FZU The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, Expressed with SUMO tag Deposited 2023-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–111（65 aa）	Not recorded	K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES 2.0M ammonium sulfate	Resolution 1.90 Å R-free 0.266
8FZU The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, Expressed with SUMO tag Deposited 2023-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 47–111（65 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES 2.0M ammonium sulfate	Resolution 1.90 Å R-free 0.266
8FZV The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, expressed with SUMO tag Deposited 2023-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–111（65 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；100 mM sodium acetate, pH 4.6, 2.0 M sodium formate	Resolution 3.29 Å R-free 0.314
8FZV The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, expressed with SUMO tag Deposited 2023-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–111（65 aa）	Not recorded	UNX UNKNOWN LIGAND × 32	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；100 mM sodium acetate, pH 4.6, 2.0 M sodium formate	Resolution 3.29 Å R-free 0.314
8FZV The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, expressed with SUMO tag Deposited 2023-01-30	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 47–111（65 aa）	Not recorded	UNX UNKNOWN LIGAND × 58	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；100 mM sodium acetate, pH 4.6, 2.0 M sodium formate	Resolution 3.29 Å R-free 0.314
8THA 1TEL, non-compressed, double-helical crystal form Deposited 2023-07-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–124（78 aa）	Mutation：V112E,R80S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.5 M Bis-Tris, 0.35 M Mg-Formate, 5 mg/mL protein	Resolution 1.68 Å R-free 0.215
9CPL The ubiquitin-associated domain of human thirty-eight negative kinase 1, fused to the 2TEL crystallization chaperone via a 2-glycine linker Deposited 2024-07-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–124（78 aa） Chain A 47–121（75 aa）	Mutation：First TELSAM:R80S,V112E,Second TELSAM: R80S,UBA Domain: C610A,C644A Mutation：First TELSAM:R80S,V112E,Second TELSAM: R80S,UBA Domain: C610A,C644A	FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；100mM BisTris, pH 6.0, 960mM Mg-formate	Resolution 2.40 Å R-free 0.263
9DB5 A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker Deposited 2024-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–121（75 aa） Fragment：residues 47-121 (Uniprot numbering) of Transcription factor ETV6	Not recorded	ACY ACETIC ACID × 13 NA SODIUM ION × 8 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.6；294 K；4.0 M Ammonium acetate, 0.1 M Sodium acetate trihydrate	Resolution 1.57 Å R-free 0.196
9DOC The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, at 1.2 Angstrom resolution Deposited 2024-09-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–121（75 aa） Fragment：von Willebrand factor A domain of CMG2	Mutation：TELSAM: R80S,V112E (Uniprot numbering),vWA: C175A (Uniprot numbering)	GOL GLYCEROL × 1 PO4 PHOSPHATE ION × 2 MG MAGNESIUM ION × 7 NA SODIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.25；298 K；100 mM Bis-Tris, pH 7.25, 1350 mM Sodium Potassium Phosphate	Resolution 1.19 Å R-free 0.197
9DP8 A DARPin fused to the 1TEL crystallization chaperone via a helical Lys-Gln-Arg linker Deposited 2024-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–124（78 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；298 K；0.1 M BIS-TRIS pH 5.5, 0.3 M Magnesium formate dihydrate	Resolution 3.47 Å R-free 0.298
9DVG Crystal Structure of a DARPin Fused to the 1TEL Crystallization Chaperone via a Direct Helical Fusion in a 2-Fold Crystal Form Deposited 2024-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–121（75 aa）	Mutation：V112E in ETV6 (Uniprot numbering)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；1.5 M Ammonium Phosphate Dibasic, 0.1 M Tris	Resolution 3.54 Å R-free 0.301
9E4Q A DARPin fused to the 3TEL crystallization chaperone via a gly-gly-gly fusion Deposited 2024-10-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–124（78 aa） Chain A 47–121（75 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；0.05 M Ammonium sulfate, 0.05 M BIS-TRIS pH 6.5, Polyethylene glycol 600	Resolution 3.58 Å R-free 0.324
9FEH Crystal structure of SARS-CoV-2 nsp14 methyltransferase domain in complex with the STM957 inhibitor Deposited 2024-05-20	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–123（77 aa）	Not recorded	A1IB6 ~{N}-[[(2~{R},3~{S},4~{R},5~{R})-5-[4-azanyl-5-(2-pyridin-3-ylethynyl)pyrrolo[2,3-d]pyrimidin-7-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-3-cyano-~{N}-ethyl-4-methoxy-benzenesulfonamide × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；12.5% w/v PEG 4000, 20% w/v 1,2,6-hexanetriol; 100mM Gly-Gly/AMPD pH 8.5; 10mM spermine, 10mM spermidine, 10mM 1,4-diaminobutane, 10mM DL-ornithine	Resolution 1.99 Å R-free 0.230
9NGE The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone Deposited 2025-02-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–122（76 aa）	Mutation：R80S,L96E,V112E in ETV6, and L591V,C610A,C644A in TNK1 (Uniprot numbering)	PEG DI(HYDROXYETHYL)ETHER × 3 K POTASSIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.2M Ammonium citrate tribasic pH 7.0, 20% w/v Polyethylene Glycol 3350	Resolution 2.02 Å R-free 0.230
9NGE The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone Deposited 2025-02-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–122（76 aa）	Mutation：R80S,L96E,V112E in ETV6, and L591V,C610A,C644A in TNK1 (Uniprot numbering)	K POTASSIUM ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.2M Ammonium citrate tribasic pH 7.0, 20% w/v Polyethylene Glycol 3350	Resolution 2.02 Å R-free 0.230
9O0H The ubiquitin-associated domain of human thirty-eight negative kinase 1, fused to the 3TEL crystallization chaperone via a 2-glycine linker Deposited 2025-04-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–124（78 aa） Fragment：TNK1 portion is the ubiquitin-associated domain Chain B 47–121（75 aa） Fragment：TNK1 portion is the ubiquitin-associated domain	Mutation：V112E (Uniprot numbering) in the first ETV6 repeat, C610A,C644A (Uniprot numbering) in TNK1 Mutation：V112E (Uniprot numbering) in the first ETV6 repeat, C610A,C644A (Uniprot numbering) in TNK1	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.5M Ammonium Chloride, 0.1M BIS-TRISpropane pH 7	Resolution 2.24 Å R-free 0.249
9Q4D A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct helical fusion Deposited 2025-08-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–121（75 aa）	Mutation：L96E, V112E in ETV6 (Uniprot numbering)	EDO 1,2-ETHANEDIOL × 7 CL CHLORIDE ION × 4 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；0.07M Citric acid, 0.05M BIS-TRIS propane, 16% w/v Polyethylene Glycol 3,350	Resolution 1.30 Å R-free 0.185
9Q9E Crystal structure of a TELSAM-SUMO1 fusion protein Deposited 2025-02-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–123（77 aa）	Mutation：V73E	1PE PENTAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Na-phosphate/citric acid pH4.2, PEG600	Resolution 2.05 Å R-free 0.231
9Q9E Crystal structure of a TELSAM-SUMO1 fusion protein Deposited 2025-02-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–123（77 aa）	Mutation：V73E	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Na-phosphate/citric acid pH4.2, PEG600	Resolution 2.05 Å R-free 0.231
9Q9E Crystal structure of a TELSAM-SUMO1 fusion protein Deposited 2025-02-26	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 47–123（77 aa）	Mutation：V73E	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Na-phosphate/citric acid pH4.2, PEG600	Resolution 2.05 Å R-free 0.231
9YKB The von Willebrand factor A domain of human capillary morphogenesis gene II, fused to the 1TEL crystallization chaperone, Ala-Val linker variant, expressed with SUMO tag. Deposited 2025-10-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–123（77 aa）	Mutation：R4A,V67E,K77A,R81A,A82V,C215A	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.1 M BisTrisPropane, 1.5M Ammonium Sulfate	Resolution 2.50 Å R-free 0.194
9YKB The von Willebrand factor A domain of human capillary morphogenesis gene II, fused to the 1TEL crystallization chaperone, Ala-Val linker variant, expressed with SUMO tag. Deposited 2025-10-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 47–123（77 aa）	Mutation：R4A,V67E,K77A,R81A,A82V,C215A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.1 M BisTrisPropane, 1.5M Ammonium Sulfate	Resolution 2.50 Å R-free 0.194
9YKB The von Willebrand factor A domain of human capillary morphogenesis gene II, fused to the 1TEL crystallization chaperone, Ala-Val linker variant, expressed with SUMO tag. Deposited 2025-10-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–123（77 aa）	Mutation：R4A,V67E,K77A,R81A,A82V,C215A	MG MAGNESIUM ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.1 M BisTrisPropane, 1.5M Ammonium Sulfate	Resolution 2.50 Å R-free 0.194
9Z2L The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to the 1TEL crystallization chaperone Deposited 2025-11-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–122（76 aa）	Mutation：R46S,V78E,L90V,C109A,C143A	SO4 SULFATE ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；298 K；0.6 M Magnesium Sulfate, 0.1 Sodium Acetate	Resolution 2.02 Å R-free 0.274
9Z2L The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to the 1TEL crystallization chaperone Deposited 2025-11-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 47–122（76 aa）	Mutation：R46S,V78E,L90V,C109A,C143A	CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；298 K；0.6 M Magnesium Sulfate, 0.1 Sodium Acetate	Resolution 2.02 Å R-free 0.274
9ZB7 A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion Deposited 2025-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–121（75 aa）	Mutation：V112E	AKG 2-OXOGLUTARIC ACID × 1 NH4 AMMONIUM ION × 1 GOL GLYCEROL × 2 EOH ETHANOL × 2 K POTASSIUM ION × 5 CL CHLORIDE ION × 5 PO4 PHOSPHATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；298 K；0.4 M Ammonium phosphate monobasic	Resolution 1.24 Å R-free 0.170
9ZNB Crystal Structure of a DARPin Fused to the 1TEL Crystallization Chaperone via a Direct Helical Fusion in a 3-Fold Crystal Form Deposited 2025-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 47–121（75 aa） Fragment：residues 47-121 (Uniprot numbering) of the ETV6 portion	Mutation：V112E in ETV6 (Uniprot numbering)	ACY ACETIC ACID × 1 CL CHLORIDE ION × 4 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.6；294 K；1.0 M Magnesium sulfate hydrate, 0.1 M Sodium acetate trihydrate pH 4.6	Resolution 1.77 Å R-free 0.220

40 other PDB entries and 63 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ETV6_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 13–88； UniProt 47–122 Author chain B； PDBConstruct 13–88； UniProt 47–122

Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1

Homo sapiens

UniProt Q13470

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 590–666	Fragment：TNK1 UBA domain,TNK1 UBA domain Mutation：R80S,L96E,V112E,L591V,C610A,C644A	TLA L(+)-TARTARIC ACID × 4 NA SODIUM ION × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M Sodium Tartrate, 16% PEG 3350 Monodisperse	Resolution 1.96 Å R-free 0.247
2	Insufficient information Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 590–666	Fragment：TNK1 UBA domain,TNK1 UBA domain Mutation：R80S,L96E,V112E,L591V,C610A,C644A	TLA L(+)-TARTARIC ACID × 3 NA SODIUM ION × 4 SO4 SULFATE ION × 2 TAR D(-)-TARTARIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M Sodium Tartrate, 16% PEG 3350 Monodisperse	Resolution 1.96 Å R-free 0.247

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9ZVU	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7T8J The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused to the 1TEL crystallization chaperone via a GSGG linker Deposited 2021-12-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 590–666（77 aa）	Mutation：R80S,V112E,C610A,C644A	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；1.2 uL of 1 mg/mL protein in 50 mM Tris pH 8.8, 200 mM KCl combined with 1.2 uL of 100 mM Bis-tris-propane, 2.5 M Ammonium Nitrate	Resolution 1.89 Å R-free 0.235
7TCY The ubiquitin-associated domain of human thirty-eight negative kinase I Deposited 2021-12-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 589–666（78 aa） Fragment：UBA domain (UNP residues 589-666)	Mutation：P589G, C610A, C644A	FMT FORMIC ACID × 3 PO4 PHOSPHATE ION × 1 MG MAGNESIUM ION × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.8；298 K；100 mM Bis-Tris, pH 6.8, 100 mM magnesium formate	Resolution 1.54 Å R-free 0.214
7TCY The ubiquitin-associated domain of human thirty-eight negative kinase I Deposited 2021-12-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 589–666（78 aa） Fragment：UBA domain (UNP residues 589-666)	Mutation：P589G, C610A, C644A	FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.8；298 K；100 mM Bis-Tris, pH 6.8, 100 mM magnesium formate	Resolution 1.54 Å R-free 0.214
7TDY The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused to the 1TEL crystallization chaperone via a 2-glycine linker and crystallized at low protein concentration Deposited 2022-01-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 590–666（77 aa）	Mutation：R80S,V112E,C610A,C644A	FMT FORMIC ACID × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；1.2 uL of 2 mg/mL protein combined with 1.2 uL of 100 mM Bis-Tris, pH 7.00, 250 mM Mg-Formate.	Resolution 1.53 Å R-free 0.217
7U4W The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused to the 1TEL crystallization chaperone via a 2-glycine linker and crystallized at traditional protein concentration Deposited 2022-03-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 590–666（77 aa）	Mutation：R80S,V112E,C610A,C644A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；298 K；1.2 uL of 15 mg/mL protein combined with 1.2 uL of 100 mM Bis-Tris, pH 6.50, 750 mM Mg-Formate	Resolution 2.10 Å R-free 0.276
7U4Z The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused to the 1TEL crystallization chaperone via a 2-glycine linker and crystallized at very low protein concentration Deposited 2022-03-01	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 590–666（77 aa）	Mutation：R80S,V112E,C610A,C644A	K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；1.2 uL of 0.5 mg/mL protein combined with 1.2 uL of 100 mM Bis-Tris, pH 6.00, 630-750 mM Mg-Formate.	Resolution 2.03 Å R-free 0.232
9CPL The ubiquitin-associated domain of human thirty-eight negative kinase 1, fused to the 2TEL crystallization chaperone via a 2-glycine linker Deposited 2024-07-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 590–666（77 aa）	Mutation：First TELSAM:R80S,V112E,Second TELSAM: R80S,UBA Domain: C610A,C644A	FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；100mM BisTris, pH 6.0, 960mM Mg-formate	Resolution 2.40 Å R-free 0.263
9NGE The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone Deposited 2025-02-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 590–666（77 aa）	Mutation：R80S,L96E,V112E in ETV6, and L591V,C610A,C644A in TNK1 (Uniprot numbering)	PEG DI(HYDROXYETHYL)ETHER × 3 K POTASSIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.2M Ammonium citrate tribasic pH 7.0, 20% w/v Polyethylene Glycol 3350	Resolution 2.02 Å R-free 0.230
9NGE The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone Deposited 2025-02-22	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 590–666（77 aa）	Mutation：R80S,L96E,V112E in ETV6, and L591V,C610A,C644A in TNK1 (Uniprot numbering)	K POTASSIUM ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.2M Ammonium citrate tribasic pH 7.0, 20% w/v Polyethylene Glycol 3350	Resolution 2.02 Å R-free 0.230
9O0H The ubiquitin-associated domain of human thirty-eight negative kinase 1, fused to the 3TEL crystallization chaperone via a 2-glycine linker Deposited 2025-04-02	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 590–666（77 aa） Fragment：TNK1 portion is the ubiquitin-associated domain	Mutation：V112E (Uniprot numbering) in the first ETV6 repeat, C610A,C644A (Uniprot numbering) in TNK1	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；1.5M Ammonium Chloride, 0.1M BIS-TRISpropane pH 7	Resolution 2.24 Å R-free 0.249
9Z2L The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to the 1TEL crystallization chaperone Deposited 2025-11-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 590–666（77 aa）	Mutation：R46S,V78E,L90V,C109A,C143A	SO4 SULFATE ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；298 K；0.6 M Magnesium Sulfate, 0.1 Sodium Acetate	Resolution 2.02 Å R-free 0.274
9Z2L The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to the 1TEL crystallization chaperone Deposited 2025-11-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 590–666（77 aa）	Mutation：R46S,V78E,L90V,C109A,C143A	CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；298 K；0.6 M Magnesium Sulfate, 0.1 Sodium Acetate	Resolution 2.02 Å R-free 0.274

9 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TNK1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 89–165； UniProt 590–666 Author chain B； PDBConstruct 89–165； UniProt 590–666

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9zvu
Deposition date deposition_date	2025-12-30
最后修订 last_revision	2026-03-04
Structure title title	The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone, alternate crystal form
Keywords keywords	;Sterile Alpha Motif (SAM) of Human Translocation ETS Leukemia (TEL), protein crystallization chaperone, TELSAM, ETV6, TRANSCRIPTION, 1TEL Crystallization Chaperone, ONCOPROTEIN, TNK1, UBA, Ubiquitin-Associated Domain, Thirty-eight Negative Kinase-1 ;; ONCOPROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	23.40 Å
Radius of gyration Rg (electron density) rg_electron	22.38 Å
Forward intensity I(0) i0	21095400.00
Molecular weight molecular_weight	33746.0 kDa
Excluded volume excluded_volume	41727 Å³
Envelope volume envelope_volume	52661 Å³
Hydration-shell volume shell_volume	20534 Å³
Envelope diameter envelope_diameter	74.6 Å
Shell Rg shell_rg	28.19 Å
Envelope Rg envelope_rg	22.31 Å
Shape Rg shape_rg	22.36 Å
Total Rg total_rg	23.25 Å
Total atoms total_atoms	4523
Residues n_residues	306
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	73.1 Å
Rg (real space) rg_real	23.35 Å
Rg uncertainty (real space) rg_real_error	0.49 Å
I(0) (real space) i0_real	2.1100e+07
I(0) uncertainty (real space) i0_real_error	2.5910e+05
Rg (reciprocal space) rg_reciprocal	23.36 Å
I(0) (reciprocal space) i0_reciprocal	21100000.0000
Solution quality estimate total_estimate	0.9140
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	29.2 Å
Skewness Skewness skewness	0.210
Kurtosis Kurtosis kurtosis	-0.557
Angular range angular_range	— – 0.3400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	3832000.0000
Real-space data points n_real_points	66
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.962; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.995; Smooth: 0.998

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1
Molecular weight formula_weight	19304.7 kDa
EC 编号 ec_number	2.7.10.2
Mutation mutation	R80S,L96E,V112E,L591V,C610A,C644A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4656

MGHHHHHHHHHHSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLELTKEDFRYRSPHSGDELYELLQHILKEVQRKIMEVELSVHGVTHQEAQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADAWRILEHYQWDLSAASRYVLARP

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	L(+)-TARTARIC ACID
Molecular weight formula_weight	150.1 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 3 Entity 3 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	nat
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	D(-)-TARTARIC ACID
Molecular weight formula_weight	150.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	121

▶

8. Citations (1)

▶

Unit-cell length a length_a	38.213 Å
Unit-cell length b length_b	79.367 Å
Unit-cell length c length_c	119.173 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	1.964 Å
Low-resolution limit resolution_low	59.590 Å
R factor r_factor	0.2127
R_work r_work	0.2110
R_free r_free	0.2469

fit	/app/data/saxs_computation/zv/9zvu/9zvu.fit
pddf	/app/data/pr_computation/zv/9zvu/9zvu.pr.out
profile	/app/data/saxs_computation/zv/9zvu/9zvu.dat

The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to a double trigger variant of the 1TEL crystallization chaperone, alternate crystal form

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1

State in the Current Structure

Other States of the Same Protein in the Database

Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)