← Back to search

9q9e

Crystal structure of a TELSAM-SUMO1 fusion protein

Method: X-RAY DIFFRACTION D_max: 100.1 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9q9e
deposition_date	2025-02-26
title	Crystal structure of a TELSAM-SUMO1 fusion protein
keywords	SUMOylation, fusion protein-assisted crystallisation, TELSAM domain, SUMO1 protein, SIGNALING PROTEIN; SIGNALING PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	32.36 Å
rg_electron	31.17 Å
i0	40342300.00
molecular_weight	48850.0 kDa
excluded_volume	60666 Å³
envelope_volume	89702 Å³
shell_volume	25254 Å³
envelope_diameter	106.8 Å
shell_rg	36.44 Å
envelope_rg	30.58 Å
shape_rg	31.20 Å
total_rg	31.61 Å
total_atoms	3456
n_residues	459
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	100.1 Å
rg_real	32.31 Å
rg_real_error	0.79 Å
i0_real	4.0340e+07
i0_real_error	5.7100e+05
rg_reciprocal	32.34 Å
i0_reciprocal	40340000.0000
total_estimate	0.8794
solution_quality	GOOD a GOOD solution
n_peaks	3
r_peak_primary	45.0 Å
skewness	0.139
kurtosis	-0.510
angular_range	— – 0.2450 Å⁻¹
current_alpha	0.0000
highest_alpha	2962000.0000
n_real_points	50
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.861; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.974; Smooth: 0.873

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Transcription factor ETV6,Small ubiquitin-related modifier 1
formula_weight	19575.2 kDa
mutation	V73E
src_method	man
entity_count	3

Polymer

type	polypeptide(L)
strand_id	A,B,C
atom_count	3669

MHHHHHHSIALPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILAQPAAEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 non-polymer

description	PENTAETHYLENE GLYCOL
formula_weight	238.3 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	PHOSPHATE ION
formula_weight	95.0 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	208

▶

6. Citations (1)

▶

length_a	54.726 Å
length_b	99.692 Å
length_c	113.576 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	12

space_group	P 21 21 21
int_tables_number	19
crystal_system	orthorhombic

resolution	2.050 Å
resolution_low	47.970 Å
r_factor	0.2104
r_work	0.2094
r_free	0.2312

fit	/app/data/saxs_computation/q9/9q9e/9q9e.fit
pddf	/app/data/pr_computation/q9/9q9e/9q9e.pr.out
profile	/app/data/saxs_computation/q9/9q9e/9q9e.dat

Crystal structure of a TELSAM-SUMO1 fusion protein

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction