SAXSdb — 8fz3

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor ETV6, Activated CDC42 kinase 1 fusion

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	CHLORIDE ION × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	PHOSPHATE ION × 1 water × 1	Consistent with protein count
3	Insufficient information	Monomer	Protein 1	CHLORIDE ION × 1 water × 1	Consistent with protein count
4	Insufficient information	Monomer	Protein 1	water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ETV6_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 12–88； UniProt 47–123 Author chain B； PDBConstruct 12–88； UniProt 47–123 Author chain C； PDBConstruct 12–88； UniProt 47–123 Author chain D； PDBConstruct 12–88； UniProt 47–123

Transcription factor ETV6, Activated CDC42 kinase 1 fusion

Homo sapiens

UniProt Q07912

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	CHLORIDE ION × 1 water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	PHOSPHATE ION × 1 water × 1	Consistent with protein count
3	Insufficient information	Monomer	Protein 1	CHLORIDE ION × 1 water × 1	Consistent with protein count
4	Insufficient information	Monomer	Protein 1	water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACK1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 90–170； UniProt 958–1038 Author chain B； PDBConstruct 90–170； UniProt 958–1038 Author chain C； PDBConstruct 90–170； UniProt 958–1038 Author chain D； PDBConstruct 90–170； UniProt 958–1038

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8fz3
Deposition date deposition_date	2023-01-27
Structure title title	Sterile Alpha Motif of Human Translocation ETS Leukemia, Non-Polymer Crystal Form
Keywords keywords	Sterile Alpha Motif, Ubiquitin Associated Domain, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8fz3__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8fz3__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8fz3__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	13.34 Å
Rg (electron density)	11.64 Å
Total Rg	13.16 Å
Atom count	1244
Residues	78
Excluded volume	11320 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8fz3__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8fz3__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`8fz3__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`8fz3__assembly_4__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Transcription factor ETV6, Activated CDC42 kinase 1 fusion
Molecular weight formula_weight	19810.5 kDa
EC 编号 ec_number	2.7.10.2,2.7.11.1
Mutation mutation	R45S, V77E
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	4731

GHHHHHHHHHHSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILKQGPADKIQMAMVHGVTTEECQAALQCHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSWGPAHHKR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	31

▶

Unit-cell length a length_a	61.506 Å
Unit-cell length b length_b	61.506 Å
Unit-cell length c length_c	166.139 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 65
Space-group number int_tables_number	170
Crystal system crystal_system	hexagonal

Resolution resolution	2.784 Å
Low-resolution limit resolution_low	44.840 Å
R factor r_factor	0.2306
R_work r_work	0.2286
R_free r_free	0.2665

Sterile Alpha Motif of Human Translocation ETS Leukemia, Non-Polymer Crystal Form

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor ETV6, Activated CDC42 kinase 1 fusion

State in the Current Structure

Other States of the Same Protein in the Database

Transcription factor ETV6, Activated CDC42 kinase 1 fusion

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8fz3__assembly_1__model_1

8fz3__assembly_1__model_1 | I(q)

8fz3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Sterile Alpha Motif of Human Translocation ETS Leukemia, Non-Polymer Crystal Form

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcription factor ETV6, Activated CDC42 kinase 1 fusion

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transcription factor ETV6, Activated CDC42 kinase 1 fusion

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8fz3__assembly_1__model_1

8fz3__assembly_1__model_1 | I(q)

8fz3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)