← Back to search

10oq

FGFR2 mutant D650V with compound 6

Method: X-RAY DIFFRACTION D_max: 89.2 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	10oq
deposition_date	2026-01-29
last_revision	2026-04-15
title	FGFR2 mutant D650V with compound 6
keywords	FGFR, FGFR2, Fibroblast growth factor receptor, Tyrosine Kinase, Resistance Mutations, compound 6, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	27.25 Å
rg_electron	26.69 Å
i0	144870000.00
molecular_weight	63646.0 kDa
excluded_volume	61533 Å³
envelope_volume	104440 Å³
shell_volume	32669 Å³
envelope_diameter	95.9 Å
shell_rg	34.00 Å
envelope_rg	26.69 Å
shape_rg	26.69 Å
total_rg	27.23 Å
total_atoms	4790
n_residues	590
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	89.2 Å
rg_real	27.23 Å
rg_real_error	0.60 Å
i0_real	1.4490e+08
i0_real_error	1.9910e+06
rg_reciprocal	27.24 Å
i0_reciprocal	144900000.0000
total_estimate	0.8918
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	30.8 Å
skewness	0.347
kurtosis	-0.360
angular_range	— – 0.2900 Å⁻¹
current_alpha	0.0000
highest_alpha	32470000.0000
n_real_points	59
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.882; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.947

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Fibroblast growth factor receptor 2
formula_weight	37126.7 kDa
ec_number	2.7.10.1
mutation	D650V
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	4858

MGSSHHHHHHSQDPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARVINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEE

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 non-polymer

description	N-[(3M)-3-{5-chloro-2-[4-(morpholin-4-yl)anilino]pyrimidin-4-yl}-1-methyl-1H-indol-6-yl]propanamide
formula_weight	491.0 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	4

Entity 4 non-polymer

description	SULFATE ION
formula_weight	96.1 kDa
src_method	syn
entity_count	1

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	65

▶

6. Citations (1)

▶

length_a	96.743 Å
length_b	96.743 Å
length_c	145.622 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	12

space_group	P 31 2 1
int_tables_number	152
crystal_system	—

resolution	1.980 Å
resolution_low	54.966 Å
r_factor	0.2062
r_work	0.2038
r_free	0.2514

fit	/app/data/saxs_computation/0o/10oq/10oq.fit
pddf	/app/data/pr_computation/0o/10oq/10oq.pr.out
profile	/app/data/saxs_computation/0o/10oq/10oq.dat