← Back to search

10oo

FGFR2 mutant D650V with compound 4 (AZD3463)

Method: X-RAY DIFFRACTION D_max: 84.3 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	10oo
deposition_date	2026-01-29
last_revision	2026-04-15
title	FGFR2 mutant D650V with compound 4 (AZD3463)
keywords	FGFR2, FGFR, Fibroblast growth factor receptor, Tyrosine Kinase, Resistance Mutations, AZD3463, compound 4, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	26.51 Å
rg_electron	25.81 Å
i0	134410000.00
molecular_weight	60928.0 kDa
excluded_volume	58788 Å³
envelope_volume	100320 Å³
shell_volume	31942 Å³
envelope_diameter	90.5 Å
shell_rg	33.45 Å
envelope_rg	25.72 Å
shape_rg	25.80 Å
total_rg	26.41 Å
total_atoms	4582
n_residues	561
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	84.3 Å
rg_real	26.42 Å
rg_real_error	0.51 Å
i0_real	1.3440e+08
i0_real_error	1.6960e+06
rg_reciprocal	26.45 Å
i0_reciprocal	134400000.0000
total_estimate	0.9059
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	30.9 Å
skewness	0.224
kurtosis	-0.502
angular_range	— – 0.3000 Å⁻¹
current_alpha	0.0000
highest_alpha	35490000.0000
n_real_points	61
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.926; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.997

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Fibroblast growth factor receptor 2
formula_weight	37126.7 kDa
ec_number	2.7.10.1
mutation	D650V
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,B
atom_count	4734

MGSSHHHHHHSQDPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARVINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEE

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 non-polymer

description	(4P)-N-[4-(4-aminopiperidin-1-yl)-2-methoxyphenyl]-5-chloro-4-(1H-indol-3-yl)pyrimidin-2-amine
formula_weight	448.9 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	1

Entity 4 non-polymer

description	SULFATE ION
formula_weight	96.1 kDa
src_method	nat
entity_count	5

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	152

▶

6. Citations (1)

▶

length_a	66.932 Å
length_b	77.985 Å
length_c	116.071 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	1.850 Å
resolution_low	39.020 Å
r_factor	0.2132
r_work	0.2109
r_free	0.2558

fit	/app/data/saxs_computation/0o/10oo/10oo.fit
pddf	/app/data/pr_computation/0o/10oo/10oo.pr.out
profile	/app/data/saxs_computation/0o/10oo/10oo.dat