SAXSdb — 1dfl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MYOSIN HEAD

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 5–835	Fragment：HEAVY CHAIN	MYOSIN HEAD × 1 （P13543） MYOSIN HEAD × 1 （P07291） MG MAGNESIUM ION × 2 VO4 VANADATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；PEG 8000, MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 4K	Resolution 4.20 Å R-free 0.400
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain B； UniProt 5–835	Fragment：HEAVY CHAIN	MYOSIN HEAD × 1 （P13543） MYOSIN HEAD × 1 （P07291） MG MAGNESIUM ION × 2 VO4 VANADATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；PEG 8000, MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 4K	Resolution 4.20 Å R-free 0.400

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1DFL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B7T MYOSIN DIGESTED BY PAPAIN Deposited 1999-01-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–835（835 aa） Fragment：PAPAIN DIGESTED, SUBFRAGMENT 1 (S1)	Not recorded	MG MAGNESIUM ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8.0	Resolution 2.50 Å R-free 0.297
1DFK NUCLEOTIDE-FREE SCALLOP MYOSIN S1-NEAR RIGOR STATE Deposited 1999-11-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 6–835（830 aa） Fragment：HEAVY CHAIN	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG8000, ammonium sulfate, cacodylate, glycerol , pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 4K	Resolution 4.20 Å R-free 0.410
1KK7 SCALLOP MYOSIN IN THE NEAR RIGOR CONFORMATION Deposited 2001-12-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–837（837 aa） Fragment：HEAVY CHAIN	Not recorded	SO4 SULFATE ION × 1 MG MAGNESIUM ION × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.3；277 K；PEG 5000, ammonium sulphate, MgCl2, gycerol, cacodylate, pH 6.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.20 Å R-free 0.313
1KK8 SCALLOP MYOSIN (S1-ADP-BeFx) IN THE ACTIN-DETACHED CONFORMATION Deposited 2001-12-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–837（837 aa） Fragment：MYOSIN HEAVY CHAIN	Mutation：FRAGMENT: PAPAIN DIGESTED, SUBFRAGMENT 1 (S1)	MG MAGNESIUM ION × 2 BEF BERYLLIUM TRIFLUORIDE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 GOL GLYCEROL × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, ADP-berillium floride, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.269
1KQM SCALLOP MYOSIN S1-AMPPNP IN THE ACTIN-DETACHED CONFORMATION Deposited 2002-01-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–835（835 aa） Fragment：SUBFRAGMENT 1(S1)	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, AMPPNP, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.00 Å R-free 0.316
1KWO SCALLOP MYOSIN S1-ATPgammaS-p-PDM IN THE ACTIN-DETACHED CONFORMATION Deposited 2002-01-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–835（835 aa） Fragment：SUBFRAGMENT 1(S1)	Not recorded	MG MAGNESIUM ION × 2 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 PDM 4-[4-(2,5-DIOXO-PYRROLIDIN-1-YL)-PHENYLAMINO]-4-HYDROXY-BUTYRIC ACID × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, ATPgammaS, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.80 Å R-free 0.328
1L2O SCALLOP MYOSIN S1-ADP-p-PDM IN THE ACTIN-DETACHED CONFORMATION Deposited 2002-02-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–835（835 aa） Fragment：SUBFRAGMENT 1(S1)	Not recorded	MG MAGNESIUM ION × 2 PDM 4-[4-(2,5-DIOXO-PYRROLIDIN-1-YL)-PHENYLAMINO]-4-HYDROXY-BUTYRIC ACID × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, ATPgammaS, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.327
1QVI Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom resolution: flexibility and function in the head Deposited 2003-08-27	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–840（840 aa）	Not recorded	MG MAGNESIUM ION × 2 VO4 VANADATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；MES, MgCl2, ADP, Na3VO4, polyethylene glycol 8K, glycerol, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.54 Å R-free 0.266
1S5G Structure of Scallop myosin S1 reveals a novel nucleotide conformation Deposited 2004-01-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–840（840 aa） Fragment：Residues 1-840	Not recorded	SO4 SULFATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；300 K；PEG 8000, magnesium chloride, ADP, Glycerol, MES, TMAO, cacodylate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 300K	Resolution 3.10 Å R-free 0.269
1SCM STRUCTURE OF THE REGULATORY DOMAIN OF SCALLOP MYOSIN AT 2.8 ANGSTROMS RESOLUTION Deposited 1994-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 777–836（60 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1SR6 Structure of nucleotide-free scallop myosin S1 Deposited 2004-03-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–840（840 aa）	Not recorded	SO4 SULFATE ION × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；300 K；6% PEG 8000, 50mM ammonium sulfate, 8% glycerol, 10mM magnesium chloride, 50mM sodium cacodylate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 2.75 Å R-free 0.286
1WDC SCALLOP MYOSIN REGULATORY DOMAIN Deposited 1996-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 774–837（64 aa） Fragment：PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN	Not recorded	MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.0	Resolution 2.00 Å R-free 0.281
2W4T ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE Deposited 2008-12-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 5–835（831 aa） Fragment：RESIDUES 5-835	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM	Resolution 35.00 Å
2W4V Isometrically contracting insect asynchronous flight muscle quick frozen after a quick release step Deposited 2008-12-02	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 5–835（831 aa） Fragment：RESIDUES 5-835	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM；SMASH AGAINST A LIQUID HELIUM COOLED GOLD COATED COPPER MIRROR	Resolution 35.00 Å
2W4W Isometrically contracting insect asynchronous flight muscle quick frozen after a quick stretch step Deposited 2008-12-02	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 5–835（831 aa） Fragment：RESIDUES 5-835	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM；SMASH AGAINST A LIQUID HELIUM COOLED GOLD COATED COPPER MIRROR	Resolution 35.00 Å
3BAS Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (C2) form Deposited 2007-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 835–885（51 aa） Fragment：Bay Scallop Myosin (Residues 835-885)/Yeast GCN4 Transcription Factor (Residues 250-281) Chain B 835–885（51 aa） Fragment：Bay Scallop Myosin (Residues 835-885)/Yeast GCN4 Transcription Factor (Residues 250-281)	Not recorded	IOD IODIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；277 K；1.5 microliter of protein solution (4 mg/ml protein in 30 mM MOPS buffer pH 7.2, 40 mM NaCl, 2 mM NaN3) mixed with 3 microliters of (16.6% PEG 3350, 4.6% MPD, 13 mM NaCl, 2 mM NaN3, 10 mM MOPS pH 7.2) and equilibrated against (15% PEG 3350, 4.2% MPD, 18 mM MOPS, 24 mM NaCl), VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.287
3BAT Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (P21) form Deposited 2007-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 835–885（51 aa） Fragment：Bay Scallop Myosin (Residues 835-885)/Yeast GCN4 Transcription Factor (Residues 250-281) Chain B 835–885（51 aa） Fragment：Bay Scallop Myosin (Residues 835-885)/Yeast GCN4 Transcription Factor (Residues 250-281)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；277 K；2 microliters of protein solution (4 mg/ml protein in 30 mM MOPS buffer pH 7.2, 40 mM NaCl, 2 mM NaN3) mixed with 2 microliters of (25% PEG 3350, 50 mM NH4I) and equilibrated against 1 ml of (17.5% PEG 3350, 35 mM NH4I, 28 mM NaCl, 2 mM NaN3, 20 mM MOPS pH 6.2). Harvested crystals were cryoprotected in 25.5% PEG 3350 and 15% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.299
3BAT Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (P21) form Deposited 2007-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 835–885（51 aa） Fragment：Bay Scallop Myosin (Residues 835-885)/Yeast GCN4 Transcription Factor (Residues 250-281) Chain D 835–885（51 aa） Fragment：Bay Scallop Myosin (Residues 835-885)/Yeast GCN4 Transcription Factor (Residues 250-281)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；277 K；2 microliters of protein solution (4 mg/ml protein in 30 mM MOPS buffer pH 7.2, 40 mM NaCl, 2 mM NaN3) mixed with 2 microliters of (25% PEG 3350, 50 mM NH4I) and equilibrated against 1 ml of (17.5% PEG 3350, 35 mM NH4I, 28 mM NaCl, 2 mM NaN3, 20 mM MOPS pH 6.2). Harvested crystals were cryoprotected in 25.5% PEG 3350 and 15% glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.30 Å R-free 0.299
3JTD Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation Deposited 2009-09-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 773–837（65 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；277 K；100 mM bicine pH 8.3, 45 mM ammonium sulfate, 5 mM magnesium chloride, 2.5 mM EGTA, 3.0 mM sodium azide, 15% (wt/vol) PEG 4000, 4% (vol/vol) PEG 200, 6% (wt/vol) 2,3-butanediol, Hanging drop vapor diffusion, temperature 277K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.57 Å R-free 0.248
3JVT Calcium-bound Scallop Myosin Regulatory Domain (Lever Arm) with Reconstituted Complete Light Chains Deposited 2009-09-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 775–837（63 aa）	Not recorded	MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；277 K；150 mM HEPES pH 7.0, 50 mM Ammonium Sulfate, 0.5 mM Calcium Chloride, 5 mM Magnesium Chloride, 5 mM Sodium Azide, 16.5% (wt/vol) PEG 4000 combined with equal volume of 16.9 mg/ml protein in 5 mM HEPES pH 7, 20 mM NaCl, 2 mM Magnesium Chloride, 0.2 mM Calcium Chloride, 0.1 mM EGTA, 3.0 mM Sodium Azide, Hanging drop vapor diffusion, temperature 277K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.10 Å R-free 0.231

19 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MYS_AEQIR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–831； UniProt 5–835 Author chain B； PDBConstruct 1–831； UniProt 5–835

MYOSIN HEAD

OrganismNot specified

UniProt P13543

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain Y； UniProt 13–151	Fragment：REGULATORY LIGHT CHAIN	MYOSIN HEAD × 1 （P24733） MYOSIN HEAD × 1 （P07291） MG MAGNESIUM ION × 2 VO4 VANADATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；PEG 8000, MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 4K	Resolution 4.20 Å R-free 0.400
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain W； UniProt 13–151	Fragment：REGULATORY LIGHT CHAIN	MYOSIN HEAD × 1 （P24733） MYOSIN HEAD × 1 （P07291） MG MAGNESIUM ION × 2 VO4 VANADATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；PEG 8000, MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 4K	Resolution 4.20 Å R-free 0.400

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1DFL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B7T MYOSIN DIGESTED BY PAPAIN Deposited 1999-01-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Y 2–157（156 aa） Fragment：PAPAIN DIGESTED, SUBFRAGMENT 1 (S1)	Not recorded	MG MAGNESIUM ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8.0	Resolution 2.50 Å R-free 0.297
1DFK NUCLEOTIDE-FREE SCALLOP MYOSIN S1-NEAR RIGOR STATE Deposited 1999-11-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Y 13–151（139 aa） Fragment：REGULATORY LIGHT CHAIN	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG8000, ammonium sulfate, cacodylate, glycerol , pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 4K	Resolution 4.20 Å R-free 0.410
1KK7 SCALLOP MYOSIN IN THE NEAR RIGOR CONFORMATION Deposited 2001-12-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Y 1–156（156 aa） Fragment：REGULATORY LIGHT CHAIN	Not recorded	SO4 SULFATE ION × 1 MG MAGNESIUM ION × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.3；277 K；PEG 5000, ammonium sulphate, MgCl2, gycerol, cacodylate, pH 6.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.20 Å R-free 0.313
1KK8 SCALLOP MYOSIN (S1-ADP-BeFx) IN THE ACTIN-DETACHED CONFORMATION Deposited 2001-12-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 13–151（139 aa） Fragment：MYOSIN REGULATORY LIGHT CHAIN	Not recorded	MG MAGNESIUM ION × 2 BEF BERYLLIUM TRIFLUORIDE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 GOL GLYCEROL × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, ADP-berillium floride, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.269
1KQM SCALLOP MYOSIN S1-AMPPNP IN THE ACTIN-DETACHED CONFORMATION Deposited 2002-01-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, AMPPNP, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.00 Å R-free 0.316
1KWO SCALLOP MYOSIN S1-ATPgammaS-p-PDM IN THE ACTIN-DETACHED CONFORMATION Deposited 2002-01-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 2 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 PDM 4-[4-(2,5-DIOXO-PYRROLIDIN-1-YL)-PHENYLAMINO]-4-HYDROXY-BUTYRIC ACID × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, ATPgammaS, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.80 Å R-free 0.328
1L2O SCALLOP MYOSIN S1-ADP-p-PDM IN THE ACTIN-DETACHED CONFORMATION Deposited 2002-02-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 2 PDM 4-[4-(2,5-DIOXO-PYRROLIDIN-1-YL)-PHENYLAMINO]-4-HYDROXY-BUTYRIC ACID × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, ATPgammaS, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.327
1QVI Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom resolution: flexibility and function in the head Deposited 2003-08-27	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Y 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 2 VO4 VANADATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；MES, MgCl2, ADP, Na3VO4, polyethylene glycol 8K, glycerol, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.54 Å R-free 0.266
1S5G Structure of Scallop myosin S1 reveals a novel nucleotide conformation Deposited 2004-01-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Y 1–156（156 aa）	Not recorded	SO4 SULFATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；300 K；PEG 8000, magnesium chloride, ADP, Glycerol, MES, TMAO, cacodylate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 300K	Resolution 3.10 Å R-free 0.269
1SCM STRUCTURE OF THE REGULATORY DOMAIN OF SCALLOP MYOSIN AT 2.8 ANGSTROMS RESOLUTION Deposited 1994-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 12–156（145 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1SR6 Structure of nucleotide-free scallop myosin S1 Deposited 2004-03-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–156（156 aa）	Not recorded	SO4 SULFATE ION × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；300 K；6% PEG 8000, 50mM ammonium sulfate, 8% glycerol, 10mM magnesium chloride, 50mM sodium cacodylate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 2.75 Å R-free 0.286
1WDC SCALLOP MYOSIN REGULATORY DOMAIN Deposited 1996-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–156（156 aa） Fragment：PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN	Not recorded	MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.0	Resolution 2.00 Å R-free 0.281
2W4T ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE Deposited 2008-12-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain Y 16–151（136 aa） Fragment：RESIDUES 16-151	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM	Resolution 35.00 Å
2W4V Isometrically contracting insect asynchronous flight muscle quick frozen after a quick release step Deposited 2008-12-02	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Y 16–151（136 aa） Fragment：RESIDUES 16-151	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM；SMASH AGAINST A LIQUID HELIUM COOLED GOLD COATED COPPER MIRROR	Resolution 35.00 Å
2W4W Isometrically contracting insect asynchronous flight muscle quick frozen after a quick stretch step Deposited 2008-12-02	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Y 16–151（136 aa） Fragment：RESIDUES 16-151	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM；SMASH AGAINST A LIQUID HELIUM COOLED GOLD COATED COPPER MIRROR	Resolution 35.00 Å
3JTD Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation Deposited 2009-09-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 2–157（156 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；277 K；100 mM bicine pH 8.3, 45 mM ammonium sulfate, 5 mM magnesium chloride, 2.5 mM EGTA, 3.0 mM sodium azide, 15% (wt/vol) PEG 4000, 4% (vol/vol) PEG 200, 6% (wt/vol) 2,3-butanediol, Hanging drop vapor diffusion, temperature 277K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.57 Å R-free 0.248
3JVT Calcium-bound Scallop Myosin Regulatory Domain (Lever Arm) with Reconstituted Complete Light Chains Deposited 2009-09-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 2–157（156 aa）	Not recorded	MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；277 K；150 mM HEPES pH 7.0, 50 mM Ammonium Sulfate, 0.5 mM Calcium Chloride, 5 mM Magnesium Chloride, 5 mM Sodium Azide, 16.5% (wt/vol) PEG 4000 combined with equal volume of 16.9 mg/ml protein in 5 mM HEPES pH 7, 20 mM NaCl, 2 mM Magnesium Chloride, 0.2 mM Calcium Chloride, 0.1 mM EGTA, 3.0 mM Sodium Azide, Hanging drop vapor diffusion, temperature 277K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.10 Å R-free 0.231

17 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MLR_AEQIR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain W； PDBConstruct 1–139； UniProt 13–151 Author chain Y； PDBConstruct 1–139； UniProt 13–151

MYOSIN HEAD

OrganismNot specified

UniProt P07291

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain Z； UniProt 4–155	Fragment：ESSENTIAL LIGHT CHAIN	MYOSIN HEAD × 1 （P24733） MYOSIN HEAD × 1 （P13543） MG MAGNESIUM ION × 2 VO4 VANADATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；PEG 8000, MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 4K	Resolution 4.20 Å R-free 0.400
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain X； UniProt 4–155	Fragment：ESSENTIAL LIGHT CHAIN	MYOSIN HEAD × 1 （P24733） MYOSIN HEAD × 1 （P13543） MG MAGNESIUM ION × 2 VO4 VANADATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；PEG 8000, MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 4K	Resolution 4.20 Å R-free 0.400

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1DFL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B7T MYOSIN DIGESTED BY PAPAIN Deposited 1999-01-15	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Z 2–157（156 aa） Fragment：PAPAIN DIGESTED, SUBFRAGMENT 1 (S1)	Not recorded	MG MAGNESIUM ION × 2 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8.0	Resolution 2.50 Å R-free 0.297
1DFK NUCLEOTIDE-FREE SCALLOP MYOSIN S1-NEAR RIGOR STATE Deposited 1999-11-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Z 4–155（152 aa） Fragment：ESSENTIAL LIGHT CHAIN	Not recorded	CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；PEG8000, ammonium sulfate, cacodylate, glycerol , pH 7, VAPOR DIFFUSION, HANGING DROP, temperature 4K	Resolution 4.20 Å R-free 0.410
1KK7 SCALLOP MYOSIN IN THE NEAR RIGOR CONFORMATION Deposited 2001-12-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Z 1–156（156 aa） Fragment：ESSENTIAL LIGHT CHAIN	Not recorded	SO4 SULFATE ION × 1 MG MAGNESIUM ION × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.3；277 K；PEG 5000, ammonium sulphate, MgCl2, gycerol, cacodylate, pH 6.3, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.20 Å R-free 0.313
1KK8 SCALLOP MYOSIN (S1-ADP-BeFx) IN THE ACTIN-DETACHED CONFORMATION Deposited 2001-12-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–154（154 aa） Fragment：MYOSIN ESSENTIAL LIGHT CHAIN	Not recorded	MG MAGNESIUM ION × 2 BEF BERYLLIUM TRIFLUORIDE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 GOL GLYCEROL × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, ADP-berillium floride, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.30 Å R-free 0.269
1KQM SCALLOP MYOSIN S1-AMPPNP IN THE ACTIN-DETACHED CONFORMATION Deposited 2002-01-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, AMPPNP, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.00 Å R-free 0.316
1KWO SCALLOP MYOSIN S1-ATPgammaS-p-PDM IN THE ACTIN-DETACHED CONFORMATION Deposited 2002-01-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 2 AGS PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER × 1 PDM 4-[4-(2,5-DIOXO-PYRROLIDIN-1-YL)-PHENYLAMINO]-4-HYDROXY-BUTYRIC ACID × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, ATPgammaS, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.80 Å R-free 0.328
1L2O SCALLOP MYOSIN S1-ADP-p-PDM IN THE ACTIN-DETACHED CONFORMATION Deposited 2002-02-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 2 PDM 4-[4-(2,5-DIOXO-PYRROLIDIN-1-YL)-PHENYLAMINO]-4-HYDROXY-BUTYRIC ACID × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；PEG 20000, magnesium chloride, ethylene glycol, Tris HCl, ATPgammaS, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.327
1QVI Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom resolution: flexibility and function in the head Deposited 2003-08-27	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Z 1–156（156 aa）	Not recorded	MG MAGNESIUM ION × 2 VO4 VANADATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；MES, MgCl2, ADP, Na3VO4, polyethylene glycol 8K, glycerol, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.54 Å R-free 0.266
1S5G Structure of Scallop myosin S1 reveals a novel nucleotide conformation Deposited 2004-01-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Z 1–156（156 aa）	Not recorded	SO4 SULFATE ION × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；300 K；PEG 8000, magnesium chloride, ADP, Glycerol, MES, TMAO, cacodylate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 300K	Resolution 3.10 Å R-free 0.269
1SCM STRUCTURE OF THE REGULATORY DOMAIN OF SCALLOP MYOSIN AT 2.8 ANGSTROMS RESOLUTION Deposited 1994-01-06	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 4–152（149 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1SR6 Structure of nucleotide-free scallop myosin S1 Deposited 2004-03-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–156（156 aa）	Not recorded	SO4 SULFATE ION × 1 MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；300 K；6% PEG 8000, 50mM ammonium sulfate, 8% glycerol, 10mM magnesium chloride, 50mM sodium cacodylate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 2.75 Å R-free 0.286
1WDC SCALLOP MYOSIN REGULATORY DOMAIN Deposited 1996-01-19	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–156（156 aa） Fragment：PROTEOLYTIC FRAGMENT, REGULATORY DOMAIN	Not recorded	MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；pH 7.0	Resolution 2.00 Å R-free 0.281
2W4T ISOMETRICALLY CONTRACTING INSECT ASYNCHRONOUS FLIGHT MUSCLE Deposited 2008-12-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain Z 5–155（151 aa） Fragment：RESIDUES 5-155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM	Resolution 35.00 Å
2W4V Isometrically contracting insect asynchronous flight muscle quick frozen after a quick release step Deposited 2008-12-02	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Z 5–155（151 aa） Fragment：RESIDUES 5-155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM；SMASH AGAINST A LIQUID HELIUM COOLED GOLD COATED COPPER MIRROR	Resolution 35.00 Å
2W4W Isometrically contracting insect asynchronous flight muscle quick frozen after a quick stretch step Deposited 2008-12-02	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain Z 5–155（151 aa） Fragment：RESIDUES 5-155	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS；20 MM MOPS BUFFER, 5 MM NAN3, AND MGCL2, ATP, CACL2, AND EGTA IN VARYING MILLIMOLAR CONCENTRATIONS cryo-EM vitrification conditions Cryogen HELIUM；SMASH AGAINST A LIQUID HELIUM COOLED GOLD COATED COPPER MIRROR	Resolution 35.00 Å
3JTD Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation Deposited 2009-09-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 2–157（156 aa）	Mutation：D19A	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；277 K；100 mM bicine pH 8.3, 45 mM ammonium sulfate, 5 mM magnesium chloride, 2.5 mM EGTA, 3.0 mM sodium azide, 15% (wt/vol) PEG 4000, 4% (vol/vol) PEG 200, 6% (wt/vol) 2,3-butanediol, Hanging drop vapor diffusion, temperature 277K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.57 Å R-free 0.248
3JVT Calcium-bound Scallop Myosin Regulatory Domain (Lever Arm) with Reconstituted Complete Light Chains Deposited 2009-09-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 2–157（156 aa）	Not recorded	MG MAGNESIUM ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；277 K；150 mM HEPES pH 7.0, 50 mM Ammonium Sulfate, 0.5 mM Calcium Chloride, 5 mM Magnesium Chloride, 5 mM Sodium Azide, 16.5% (wt/vol) PEG 4000 combined with equal volume of 16.9 mg/ml protein in 5 mM HEPES pH 7, 20 mM NaCl, 2 mM Magnesium Chloride, 0.2 mM Calcium Chloride, 0.1 mM EGTA, 3.0 mM Sodium Azide, Hanging drop vapor diffusion, temperature 277K, VAPOR DIFFUSION, HANGING DROP	Resolution 2.10 Å R-free 0.231

17 other PDB entries and 17 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MLE_AEQIR
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain X； PDBConstruct 1–152； UniProt 4–155 Author chain Z； PDBConstruct 1–152； UniProt 4–155

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1dfl
Deposition date deposition_date	1999-11-19
Structure title title	SCALLOP MYOSIN S1 COMPLEXED WITH MGADP:VANADATE-TRANSITION STATE
Keywords keywords	MYOSIN MOTOR, CONFORMATIONAL CHANGES, CONTRACTILE PROTEIN; CONTRACTILE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	55.82 Å
Radius of gyration Rg (electron density) rg_electron	56.14 Å
Forward intensity I(0) i0	478509000.00
Molecular weight molecular_weight	147300.0 kDa
Excluded volume excluded_volume	169120 Å³
Envelope volume envelope_volume	405160 Å³
Hydration-shell volume shell_volume	62944 Å³
Envelope diameter envelope_diameter	195.2 Å
Shell Rg shell_rg	56.44 Å
Envelope Rg envelope_rg	54.47 Å
Shape Rg shape_rg	56.13 Å
Total Rg total_rg	56.16 Å
Total atoms total_atoms	10500
Residues n_residues	2112
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	196.2 Å
Rg (real space) rg_real	55.98 Å
Rg uncertainty (real space) rg_real_error	2.31 Å
I(0) (real space) i0_real	4.7850e+08
I(0) uncertainty (real space) i0_real_error	1.0730e+07
Rg (reciprocal space) rg_reciprocal	55.66 Å
I(0) (reciprocal space) i0_reciprocal	478300000.0000
Solution quality estimate total_estimate	0.8057
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	70.1 Å
Skewness Skewness skewness	0.308
Kurtosis Kurtosis kurtosis	-0.479
Angular range angular_range	— – 0.1400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	34550000.0000
Real-space data points n_real_points	29
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.847; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.928; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	MYOSIN HEAD
Molecular weight formula_weight	94843.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	10500

FSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVKVGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYTNERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNRMFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQTISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRYSILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKP

Entity 2 Entity 2 polymer

Description description	MYOSIN HEAD
Molecular weight formula_weight	15914.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,W

LPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKG

Entity 3 Entity 3 polymer

Description description	MYOSIN HEAD
Molecular weight formula_weight	17165.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,X

LSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYP

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	VANADATE ION
Molecular weight formula_weight	114.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d1dfla1
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.3 — Myosin S1 fragment, N-terminal domain
Family Family family	b.34.3.1 — Myosin S1 fragment, N-terminal domain

Domain ID domain_id	d1dfla2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.9 — Motor proteins

Domain ID domain_id	d1dflb1
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.3 — Myosin S1 fragment, N-terminal domain
Family Family family	b.34.3.1 — Myosin S1 fragment, N-terminal domain

Domain ID domain_id	d1dflb2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.9 — Motor proteins

Domain ID domain_id	d1dflw_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.5 — Calmodulin-like

Domain ID domain_id	d1dflx_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.5 — Calmodulin-like

Domain ID domain_id	d1dfly_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.5 — Calmodulin-like

Domain ID domain_id	d1dflz_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.5 — Calmodulin-like

▶

8. Citations (3)

▶

Unit-cell length a length_a	53.032 Å
Unit-cell length b length_b	243.475 Å
Unit-cell length c length_c	124.650 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.20 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	4.200 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.3940
R_work r_work	0.3940
R_free r_free	0.4000

fit	/app/data/saxs_computation/df/1dfl/1dfl.fit
pddf	/app/data/pr_computation/df/1dfl/1dfl.pr.out
profile	/app/data/saxs_computation/df/1dfl/1dfl.dat

SCALLOP MYOSIN S1 COMPLEXED WITH MGADP:VANADATE-TRANSITION STATE

1. Protein Identity and Related Structures Protein Identity & Related Structures

MYOSIN HEAD

State in the Current Structure

Other States of the Same Protein in the Database

MYOSIN HEAD

State in the Current Structure

Other States of the Same Protein in the Database

MYOSIN HEAD

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (8 domains)

8. Citations (3)

9. Files and Curves (10)

Files (7)

Curves (3)