SAXSdb — 3jtd

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin heavy chain, striated adductor muscle

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Myosin regulatory light chain, striated adductor muscle × 1 （P13543） Myosin essential light chain, striated adductor muscle × 1 （P07291） MAGNESIUM ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MYS_AEQIR
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–64； UniProt 773–837

Myosin regulatory light chain, striated adductor muscle

OrganismNot specified

UniProt P13543

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Myosin heavy chain, striated adductor muscle × 1 （P24733） Myosin essential light chain, striated adductor muscle × 1 （P07291） MAGNESIUM ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MLR_AEQIR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–156； UniProt 2–157

Myosin essential light chain, striated adductor muscle

Argopecten irradians

UniProt P07291

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Myosin heavy chain, striated adductor muscle × 1 （P24733） Myosin regulatory light chain, striated adductor muscle × 1 （P13543） MAGNESIUM ION × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MLE_AEQIR
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–155； UniProt 2–157

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3jtd
Deposition date deposition_date	2009-09-11
Structure title title	Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation
Keywords keywords	;Regulated myosins, smooth and molluscan muscle, X-ray crystallographic structure, scallop regulatory domain/lever arm, off-state, Actin-binding, ATP-binding, Calmodulin-binding, Coiled coil, Cytoplasm, Motor protein, Muscle protein, Myosin, Nucleotide-binding, Thick filament, Calcium, CONTRACTILE PROTEIN ;; CONTRACTILE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

3jtd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

3jtd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

3jtd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.00 Å
Rg (electron density)	29.88 Å
Total Rg	30.28 Å
Atom count	2971
Residues	377
Excluded volume	52888 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`3jtd__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Myosin heavy chain, striated adductor muscle
Molecular weight formula_weight	8128.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3029

MRDERLSKIISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKPLL

Entity 2 Entity 2 polymer

Description description	Myosin regulatory light chain, striated adductor muscle
Molecular weight formula_weight	17560.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAMLKEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNFNKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA

Entity 3 Entity 3 polymer

Description description	Myosin essential light chain, striated adductor muscle
Molecular weight formula_weight	17591.6 kDa
Mutation mutation	D19A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

PKLSQDEIDDLKDVFELFAFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGEKSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDEDVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK

Source Source

Source organism organism	Argopecten irradians
Common name common_name	Bay scallop
NCBI taxonomy ID ncbi_taxonomy_id	31199
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	58

▼

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d3jtdb_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.5 — Calmodulin-like

Domain ID domain_id	d3jtdc_
Class class	a — All alpha proteins
Fold Fold fold	a.39 — EF Hand-like
Superfamily Superfamily superfamily	a.39.1 — EF-hand
Family Family family	a.39.1.5 — Calmodulin-like

CATH v4.4 (5 domains)

Domain ID domain_id	3jtdA00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	270 — Myosin, subunit A
Homologous superfamily homologous superfamily	10 — Myosin, subunit A

Domain ID domain_id	3jtdB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	3jtdB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	3jtdC01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

Domain ID domain_id	3jtdC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	238 — Recoverin; domain 1
Homologous superfamily homologous superfamily	10 — EF-hand

▶

Unit-cell length a length_a	42.000 Å
Unit-cell length b length_b	52.780 Å
Unit-cell length c length_c	58.510 Å
Unit-cell angle α angle_alpha	113.36 °
Unit-cell angle β angle_beta	91.56 °
Unit-cell angle γ angle_gamma	100.60 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.570 Å
Low-resolution limit resolution_low	34.890 Å
R factor r_factor	0.2329
R_work r_work	0.2330
R_free r_free	0.2480

Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin heavy chain, striated adductor muscle

State in the Current Structure

Other States of the Same Protein in the Database

Myosin regulatory light chain, striated adductor muscle

State in the Current Structure

Other States of the Same Protein in the Database

Myosin essential light chain, striated adductor muscle

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3jtd__assembly_1__model_1

3jtd__assembly_1__model_1 | I(q)

3jtd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (2 domains)

CATH v4.4 (5 domains)

7. Citations (3)

Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Myosin heavy chain, striated adductor muscle

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Myosin regulatory light chain, striated adductor muscle

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Myosin essential light chain, striated adductor muscle

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

3jtd__assembly_1__model_1

3jtd__assembly_1__model_1 | I(q)

3jtd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (2 domains)

CATH v4.4 (5 domains)

7. Citations (3)