1pp9

Bovine cytochrome bc1 complex with stigmatellin bound

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 14 kDa protein × 2 （P00129） Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C × 2 （P13271） Ubiquinol-cytochrome C reductase complex 11 kDa protein × 2 （P00126） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 7.2 kDa protein × 2 （P00130） hexyl beta-D-glucopyranoside × 6 AZIDE ION × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 9 PHOSPHATE ION × 2 GLYCEROL × 4 PROTOPORPHYRIN IX CONTAINING FE × 4 STIGMATELLIN A × 2 Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 4 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCR1_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–446； UniProt 35–480 Author chain N； PDBConstruct 1–446； UniProt 35–480

Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial

OrganismNot specified

UniProt P23004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial × 2 （P31800） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 14 kDa protein × 2 （P00129） Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C × 2 （P13271） Ubiquinol-cytochrome C reductase complex 11 kDa protein × 2 （P00126） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 7.2 kDa protein × 2 （P00130） hexyl beta-D-glucopyranoside × 6 AZIDE ION × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 9 PHOSPHATE ION × 2 GLYCEROL × 4 PROTOPORPHYRIN IX CONTAINING FE × 4 STIGMATELLIN A × 2 Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 4 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCR2_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–439； UniProt 15–453 Author chain O； PDBConstruct 1–439； UniProt 15–453

Cytochrome b

OrganismNot specified

UniProt P00157

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial × 2 （P31800） Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial × 2 （P23004） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 14 kDa protein × 2 （P00129） Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C × 2 （P13271） Ubiquinol-cytochrome C reductase complex 11 kDa protein × 2 （P00126） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 7.2 kDa protein × 2 （P00130） hexyl beta-D-glucopyranoside × 6 AZIDE ION × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 9 PHOSPHATE ION × 2 GLYCEROL × 4 PROTOPORPHYRIN IX CONTAINING FE × 4 STIGMATELLIN A × 2 Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 4 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–379； UniProt 1–379 Author chain P； PDBConstruct 1–379； UniProt 1–379

Cytochrome c1, heme protein, mitochondrial

OrganismNot specified

UniProt P00125

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial × 2 （P31800） Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 14 kDa protein × 2 （P00129） Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C × 2 （P13271） Ubiquinol-cytochrome C reductase complex 11 kDa protein × 2 （P00126） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 7.2 kDa protein × 2 （P00130） hexyl beta-D-glucopyranoside × 6 AZIDE ION × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 9 PHOSPHATE ION × 2 GLYCEROL × 4 PROTOPORPHYRIN IX CONTAINING FE × 4 STIGMATELLIN A × 2 Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 4 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CY1_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–241； UniProt 1–241 Author chain Q； PDBConstruct 1–241； UniProt 1–241

Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial

OrganismNot specified

UniProt P13272

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial × 2 （P31800） Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Ubiquinol-cytochrome C reductase complex 14 kDa protein × 2 （P00129） Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C × 2 （P13271） Ubiquinol-cytochrome C reductase complex 11 kDa protein × 2 （P00126） Ubiquinol-cytochrome C reductase complex 7.2 kDa protein × 2 （P00130） hexyl beta-D-glucopyranoside × 6 AZIDE ION × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 9 PHOSPHATE ION × 2 GLYCEROL × 4 PROTOPORPHYRIN IX CONTAINING FE × 4 STIGMATELLIN A × 2 Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 4 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_BOVIN
Isoform	—
PDB entities	5, 9
Chains and sequence ranges	Author chain E； PDBConstruct 1–196； UniProt 79–274 Author chain R； PDBConstruct 1–196； UniProt 79–274 Author chain I； PDBConstruct 1–78； UniProt 1–78 Author chain V； PDBConstruct 1–78； UniProt 1–78

Ubiquinol-cytochrome C reductase complex 14 kDa protein

OrganismNot specified

UniProt P00129

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial × 2 （P31800） Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C × 2 （P13271） Ubiquinol-cytochrome C reductase complex 11 kDa protein × 2 （P00126） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 7.2 kDa protein × 2 （P00130） hexyl beta-D-glucopyranoside × 6 AZIDE ION × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 9 PHOSPHATE ION × 2 GLYCEROL × 4 PROTOPORPHYRIN IX CONTAINING FE × 4 STIGMATELLIN A × 2 Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 4 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCR6_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–110； UniProt 1–110 Author chain S； PDBConstruct 1–110； UniProt 1–110

Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C

OrganismNot specified

UniProt P13271

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial × 2 （P31800） Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 14 kDa protein × 2 （P00129） Ubiquinol-cytochrome C reductase complex 11 kDa protein × 2 （P00126） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 7.2 kDa protein × 2 （P00130） hexyl beta-D-glucopyranoside × 6 AZIDE ION × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 9 PHOSPHATE ION × 2 GLYCEROL × 4 PROTOPORPHYRIN IX CONTAINING FE × 4 STIGMATELLIN A × 2 Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 4 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRQ_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–81； UniProt 1–81 Author chain T； PDBConstruct 1–81； UniProt 1–81

Ubiquinol-cytochrome C reductase complex 11 kDa protein

OrganismNot specified

UniProt P00126

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial × 2 （P31800） Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 14 kDa protein × 2 （P00129） Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C × 2 （P13271） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 7.2 kDa protein × 2 （P00130） hexyl beta-D-glucopyranoside × 6 AZIDE ION × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 9 PHOSPHATE ION × 2 GLYCEROL × 4 PROTOPORPHYRIN IX CONTAINING FE × 4 STIGMATELLIN A × 2 Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 4 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRH_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–78； UniProt 1–78 Author chain U； PDBConstruct 1–78； UniProt 1–78

Ubiquinol-cytochrome C reductase complex 7.2 kDa protein

OrganismNot specified

UniProt P00130

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial × 2 （P31800） Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial × 2 （P23004） Cytochrome b × 2 （P00157） Cytochrome c1, heme protein, mitochondrial × 2 （P00125） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） Ubiquinol-cytochrome C reductase complex 14 kDa protein × 2 （P00129） Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C × 2 （P13271） Ubiquinol-cytochrome C reductase complex 11 kDa protein × 2 （P00126） Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial × 2 （P13272） hexyl beta-D-glucopyranoside × 6 AZIDE ION × 4 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 9 PHOSPHATE ION × 2 GLYCEROL × 4 PROTOPORPHYRIN IX CONTAINING FE × 4 STIGMATELLIN A × 2 Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer × 2 HEME C × 2 FE2/S2 (INORGANIC) CLUSTER × 2 CARDIOLIPIN × 4 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRX_BOVIN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–62； UniProt 1–62 Author chain W； PDBConstruct 1–62； UniProt 1–62

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1pp9
Deposition date deposition_date	2003-06-16
Structure title title	Bovine cytochrome bc1 complex with stigmatellin bound
Keywords keywords	;CYTOCHROME BC1, MEMBRANE PROTEIN, HEME PROTEIN, RIESKE IRON SULFUR PROTEIN, CYTOCHROME B, CYTOCHROME C1, COMPLEX III, MITOCHONDRIAL PROCESSING PROTEASE, MPP UBIQUINONE, OXIDOREDUCTASE, REDOX ENZYME, RESPIRATORY CHAIN, STIGMATELLIN ;; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1pp9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1pp9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1pp9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.00 Å
Rg (electron density)	54.08 Å
Total Rg	54.22 Å
Atom count	32517
Residues	4027
Excluded volume	582300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1pp9__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (22)

Entity 1 Entity 1 polymer

Description description	Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial
Molecular weight formula_weight	49266.3 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,N
Atom count atom_count	33959

TATYAQALQSVPETQVSQLDNGLRVASEQSSQPTCTVGVWIDAGSRYESEKNNGAGYFVEHLAFKGTKNRPGNALEKEVESMGAHLNAYSTREHTAYYIKALSKDLPKAVELLADIVQNCSLEDSQIEKERDVILQELQENDTSMRDVVFNYLHATAFQGTPLAQSVEGPSENVRKLSRADLTEYLSRHYKAPRMVLAAAGGLEHRQLLDLAQKHFSGLSGTYDEDAVPTLSPCRFTGSQICHREDGLPLAHVAIAVEGPGWAHPDNVALQVANAIIGHYDCTYGGGAHLSSPLASIAATNKLCQSFQTFNICYADTGLLGAHFVCDHMSIDDMMFVLQGQWMRLCTSATESEVLRGKNLLRNALVSHLDGTTPVCEDIGRSLLTYGRRIPLAEWESRIAEVDARVVREVCSKYFYDQCPAVAGFGPIEQLPDYNRIRSGMFWLRF

Entity 2 Entity 2 polymer

Description description	Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial
Molecular weight formula_weight	46575.5 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,O

SLKVAPKVKATEAPAGVPPHPQDLEFTRLPNGLVIASLENYAPASRIGLFIKAGSRYENSNNLGTSHLLRLASSLTTKGASSFKITRGIEAVGGKLSVTSTRENMAYTVECLRDDVDILMEFLLNVTTAPEFRRWEVAALQPQLRIDKAVALQNPQAHVIENLHAAAYRNALANSLYCPDYRIGKVTPVELHDYVQNHFTSARMALIGLGVSHPVLKQVAEQFLNIRGGLGLSGAKAKYHGGEIREQNGDSLVHAALVAESAAIGSAEANAFSVLQHVLGAGPHVKRGSNATSSLYQAVAKGVHQPFDVSAFNASYSDSGLFGFYTISQAASAGDVIKAAYNQVKTIAQGNLSNPDVQAAKNKLKAGYLMSVESSEGFLDEVGSQALAAGSYTPPSTVLQQIDAVADADVINAAKKFVSGRKSMAASGNLGHTPFIDEL

Entity 3 Entity 3 polymer

Description description	Cytochrome b
Molecular weight formula_weight	42620.3 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P

MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW

Entity 4 Entity 4 polymer

Description description	Cytochrome c1, heme protein, mitochondrial
Molecular weight formula_weight	27323.3 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,Q

SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK

Entity 5 Entity 5 polymer

Description description	Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial
Molecular weight formula_weight	21640.6 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,R

SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG

Entity 6 Entity 6 polymer

Description description	Ubiquinol-cytochrome C reductase complex 14 kDa protein
Molecular weight formula_weight	13371.2 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,S

AGRPAVSASSRWLEGIRKWYYNAAGFNKLGLMRDDTIHENDDVKEAIRRLPENLYDDRVFRIKRALDLSMRQQILPKEQWTKYEEDKSYLEPYLKEVIRERKEREEWAKK

Entity 7 Entity 7 polymer

Description description	Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C
Molecular weight formula_weight	9606.0 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,T

GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR

Entity 8 Entity 8 polymer

Description description	Ubiquinol-cytochrome C reductase complex 11 kDa protein
Molecular weight formula_weight	9189.1 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,U

GDPKEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK

Entity 9 Entity 9 polymer

Description description	Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial
Molecular weight formula_weight	7964.3 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,V

MLSVAARSGPFAPVLSATSRGVAGALRPLVQAAVPATSESPVLDLKRSVLCRESLRGQAAGRPLVASVSLNVPASVRY

Entity 10 Entity 10 polymer

Description description	Ubiquinol-cytochrome C reductase complex 7.2 kDa protein
Molecular weight formula_weight	7209.3 kDa
EC 编号 ec_number	1.10.2.2
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,W

VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK

Entity 11 Entity 11 non-polymer

Description description	hexyl beta-D-glucopyranoside
Molecular weight formula_weight	264.3 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 12 Entity 12 non-polymer

Description description	AZIDE ION
Molecular weight formula_weight	42.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 13 Entity 13 non-polymer

Description description	1,2-dioleoyl-sn-glycero-3-phosphoethanolamine
Molecular weight formula_weight	744.0 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 14 Entity 14 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 16 Entity 16 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 17 Entity 17 non-polymer

Description description	STIGMATELLIN A
Molecular weight formula_weight	514.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 18 Entity 18 non-polymer

Description description	Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer
Molecular weight formula_weight	863.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 19 Entity 19 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 20 Entity 20 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 21 Entity 21 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 22 Entity 22 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1437

▼

6. Fold Classification (SCOP + CATH) 58 domains

SCOP 2.08 (30 domains)

Domain ID domain_id	d1pp9a1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d1pp9a2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d1pp9b1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d1pp9b2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d1pp9c1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.32 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.32.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.32.1.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9c2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.21 — Heme-binding four-helical bundle
Superfamily Superfamily superfamily	f.21.1 — Transmembrane di-heme cytochromes
Family Family family	f.21.1.2 — Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9d1
Class class	a — All alpha proteins
Fold Fold fold	a.3 — Cytochrome c
Superfamily Superfamily superfamily	a.3.1 — Cytochrome c
Family Family family	a.3.1.3 — Cytochrome bc1 domain

Domain ID domain_id	d1pp9d2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.11 — Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor
Family Family family	f.23.11.1 — Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor

Domain ID domain_id	d1pp9e1
Class class	b — All beta proteins
Fold Fold fold	b.33 — ISP domain
Superfamily Superfamily superfamily	b.33.1 — ISP domain
Family Family family	b.33.1.1 — Rieske iron-sulfur protein (ISP)

Domain ID domain_id	d1pp9e2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.12 — ISP transmembrane anchor
Family Family family	f.23.12.1 — ISP transmembrane anchor

Domain ID domain_id	d1pp9f_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.27 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.27.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.27.1.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9g_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.13 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.13.1 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9h_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.28 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.28.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.28.1.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9i_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.184 — Non-globular alpha+beta subunits of globular proteins
Superfamily Superfamily superfamily	d.184.1 — Non-globular alpha+beta subunits of globular proteins
Family Family family	d.184.1.3 — Ubiquinol-cytochrome c reductase 8 kDa protein

Domain ID domain_id	d1pp9j_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.14 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.14.1 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9n1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d1pp9n2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d1pp9o1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d1pp9o2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.185 — LuxS/MPP-like metallohydrolase
Superfamily Superfamily superfamily	d.185.1 — LuxS/MPP-like metallohydrolase
Family Family family	d.185.1.1 — MPP-like

Domain ID domain_id	d1pp9p1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.32 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.32.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.32.1.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9p2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.21 — Heme-binding four-helical bundle
Superfamily Superfamily superfamily	f.21.1 — Transmembrane di-heme cytochromes
Family Family family	f.21.1.2 — Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9q1
Class class	a — All alpha proteins
Fold Fold fold	a.3 — Cytochrome c
Superfamily Superfamily superfamily	a.3.1 — Cytochrome c
Family Family family	a.3.1.3 — Cytochrome bc1 domain

Domain ID domain_id	d1pp9q2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.11 — Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor
Family Family family	f.23.11.1 — Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor

Domain ID domain_id	d1pp9r1
Class class	b — All beta proteins
Fold Fold fold	b.33 — ISP domain
Superfamily Superfamily superfamily	b.33.1 — ISP domain
Family Family family	b.33.1.1 — Rieske iron-sulfur protein (ISP)

Domain ID domain_id	d1pp9r2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.12 — ISP transmembrane anchor
Family Family family	f.23.12.1 — ISP transmembrane anchor

Domain ID domain_id	d1pp9s_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.27 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.27.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.27.1.1 — 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9t_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.13 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.13.1 — Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9u_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.28 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.28.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.28.1.1 — Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d1pp9v_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.184 — Non-globular alpha+beta subunits of globular proteins
Superfamily Superfamily superfamily	d.184.1 — Non-globular alpha+beta subunits of globular proteins
Family Family family	d.184.1.3 — Ubiquinol-cytochrome c reductase 8 kDa protein

Domain ID domain_id	d1pp9w_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.14 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.23.14.1 — Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

CATH v4.4 (28 domains)

Domain ID domain_id	1pp9A01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	1pp9A02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	1pp9B01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	1pp9B02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	1pp9C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	1pp9D01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	1pp9D02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	1pp9E01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	270 — Ubiquinol cytochrome reductase, transmembrane domain

Domain ID domain_id	1pp9E02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	1pp9F00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1090 — Cytochrome Bc1 Complex; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome b-c1 complex subunit 7

Domain ID domain_id	1pp9G00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	210 — Cytochrome b-c1 complex subunit 8

Domain ID domain_id	1pp9H00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	20 — Ubiquinol-cytochrome C reductase hinge domain

Domain ID domain_id	1pp9I00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	210 — Cytochrome Bc1 Complex; Chain I
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain I

Domain ID domain_id	1pp9J00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	260 — Cytochrome b-c1 complex subunit 9

Domain ID domain_id	1pp9N01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	1pp9N02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	1pp9O01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	1pp9O02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	830 — Cytochrome Bc1 Complex; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Metalloenzyme, LuxS/M16 peptidase-like

Domain ID domain_id	1pp9P00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	1pp9Q01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	100 — Cytochrome c1, transmembrane anchor, C-terminal

Domain ID domain_id	1pp9Q02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	760 — Cytochrome Bc1 Complex; Chain D, domain 2
Homologous superfamily homologous superfamily	10 — Cytochrome c-like domain

Domain ID domain_id	1pp9R01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	270 — Ubiquinol cytochrome reductase, transmembrane domain

Domain ID domain_id	1pp9R02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	1pp9S00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1090 — Cytochrome Bc1 Complex; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome b-c1 complex subunit 7

Domain ID domain_id	1pp9T00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	210 — Cytochrome b-c1 complex subunit 8

Domain ID domain_id	1pp9U00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	20 — Ubiquinol-cytochrome C reductase hinge domain

Domain ID domain_id	1pp9V00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	210 — Cytochrome Bc1 Complex; Chain I
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain I

Domain ID domain_id	1pp9W00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	260 — Cytochrome b-c1 complex subunit 9

▶

Unit-cell length a length_a	139.117 Å
Unit-cell length b length_b	171.055 Å
Unit-cell length c length_c	227.204 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.100 Å
Low-resolution limit resolution_low	24.980 Å
R factor r_factor	0.2500
R_work r_work	0.2500
R_free r_free	0.2870

Bovine cytochrome bc1 complex with stigmatellin bound

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ubiquinol-cytochrome C reductase complex core protein I, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome C reductase complex core protein 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c1, heme protein, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome C reductase iron-sulfur subunit, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome C reductase complex 14 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome C reductase complex ubiquinone-binding protein QP-C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome C reductase complex 11 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ubiquinol-cytochrome C reductase complex 7.2 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1pp9__assembly_1__model_1

1pp9__assembly_1__model_1 | I(q)

1pp9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment