1qfu

INFLUENZA VIRUS HEMAGGLUTININ COMPLEXED WITH A NEUTRALIZING ANTIBODY

Method: X-RAY DIFFRACTION D_max: 151.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (HEMAGGLUTININ (HA1 CHAIN))

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 12 其他Polymer 6 PDB declaration: dodecameric（12） Consistent with protein copy count	Chain A； UniProt 17–344 Chain B； UniProt 346–520	Fragment：BROMELAIN DIGESTED	PROTEIN (IMMUNOGLOBULIN IGG1-KAPPA ANTIBODY (LIGHT CHAIN)) × 3 PROTEIN (IMMUNOGLOBULIN IGG1-KAPPA ANTIBODY (HEAVY CHAIN)) × 3 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7；pH 7.0	Resolution 2.80 Å R-free 0.284

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1QFU	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EO8 INFLUENZA VIRUS HEMAGGLUTININ COMPLEXED WITH A NEUTRALIZING ANTIBODY Deposited 2000-03-22	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 17–344（328 aa） Fragment：BROMELAIN RELEASED FRAGMENT Chain B 346–520（175 aa） Fragment：BROMELAIN RELEASED FRAGMENT	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；28%(w:v) PEG 600, 100 mM Sodium Phosphate, 150 mM NaCl, 0.05% NaN3 , pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.80 Å R-free 0.298
1FYT CRYSTAL STRUCTURE OF A COMPLEX OF A HUMAN ALPHA/BETA-T CELL RECEPTOR, INFLUENZA HA ANTIGEN PEPTIDE, AND MHC CLASS II MOLECULE, HLA-DR1 Deposited 2000-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 322–334（13 aa） Fragment：ANTIGEN PEPTIDE	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；11% PEG 8000, 1 M NaCl, 100 mM HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 18K	Resolution 2.60 Å R-free 0.255
1HA0 HEMAGGLUTININ PRECURSOR HA0 Deposited 1998-10-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 25–518（494 aa） Fragment：HA1, HA2	Mutation：R329Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.50	Resolution 2.80 Å R-free 0.302
1HGD BINDING OF INFLUENZA VIRUS HEMAGGLUTININ TO ANALOGS OF ITS CELL-SURFACE RECEPTOR, SIALIC ACID: ANALYSIS BY PROTON NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY AND X-RAY CRYSTALLOGRAPHY Deposited 1991-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å
1HGE BINDING OF INFLUENZA VIRUS HEMAGGLUTININ TO ANALOGS OF ITS CELL-SURFACE RECEPTOR, SIALIC ACID: ANALYSIS BY PROTON NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY AND X-RAY CRYSTALLOGRAPHY Deposited 1991-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 MNA 2-O-methyl-5-N-acetyl-alpha-D-neuraminic acid × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.60 Å
1HGF BINDING OF INFLUENZA VIRUS HEMAGGLUTININ TO ANALOGS OF ITS CELL-SURFACE RECEPTOR, SIALIC ACID: ANALYSIS BY PROTON NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY AND X-RAY CRYSTALLOGRAPHY Deposited 1991-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
1HGG BINDING OF INFLUENZA VIRUS HEMAGGLUTININ TO ANALOGS OF ITS CELL-SURFACE RECEPTOR, SIALIC ACID: ANALYSIS BY PROTON NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY AND X-RAY CRYSTALLOGRAPHY Deposited 1991-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1HGH BINDING OF INFLUENZA VIRUS HEMAGGLUTININ TO ANALOGS OF ITS CELL-SURFACE RECEPTOR, SIALIC ACID: ANALYSIS BY PROTON NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY AND X-RAY CRYSTALLOGRAPHY Deposited 1991-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 MNA 2-O-methyl-5-N-acetyl-alpha-D-neuraminic acid × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å
1HGI BINDING OF INFLUENZA VIRUS HEMAGGLUTININ TO ANALOGS OF ITS CELL-SURFACE RECEPTOR, SIALIC ACID: ANALYSIS BY PROTON NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY AND X-RAY CRYSTALLOGRAPHY Deposited 1991-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 ANA methyl 4-O-acetyl-5-acetamido-3,5-dideoxy-D-glycero-alpha-D-galacto-non-2-ulopyranosidonic acid × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å
1HGJ BINDING OF INFLUENZA VIRUS HEMAGGLUTININ TO ANALOGS OF ITS CELL-SURFACE RECEPTOR, SIALIC ACID: ANALYSIS BY PROTON NUCLEAR MAGNETIC RESONANCE SPECTROSCOPY AND X-RAY CRYSTALLOGRAPHY Deposited 1991-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 AMN methyl 5-acetamido-9-amino-3,5,9-trideoxy-D-glycero-alpha-D-galacto-non-2-ulopyranosidonic acid × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.70 Å
1HTM STRUCTURE OF INFLUENZA HAEMAGGLUTININ AT THE PH OF MEMBRANE FUSION Deposited 1994-11-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–43（27 aa） Chain B 383–520（138 aa） Chain C 17–43（27 aa） Chain D 383–520（138 aa） Chain E 17–43（27 aa） Chain F 383–520（138 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.291
1J8H Crystal Structure of a Complex of a Human alpha/beta-T cell Receptor, Influenza HA Antigen Peptide, and MHC Class II Molecule, HLA-DR4 Deposited 2001-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 322–334（13 aa） Fragment：Antigen Peptide	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；291 K；13% PEG 8000, 1 M NaCl, 100 mM HEPES, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.40 Å R-free 0.246
1KEN INFLUENZA VIRUS HEMAGGLUTININ COMPLEXED WITH AN ANTIBODY THAT PREVENTS THE HEMAGGLUTININ LOW PH FUSOGENIC TRANSITION Deposited 2001-11-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain B 346–520（175 aa） Fragment：FAB fragment of antibody Chain D 346–520（175 aa） Fragment：FAB fragment of antibody Chain F 346–520（175 aa） Fragment：FAB fragment of antibody	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；peg 20000, calcium chloride, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.50 Å R-free 0.323
1QU1 CRYSTAL STRUCTURE OF EHA2 (23-185) Deposited 1999-07-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 376–530（155 aa） Chain B 376–530（155 aa） Chain C 376–530（155 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.4；2% PEG 4000, 30-150 MM NACL, pH 4.40	Resolution 1.90 Å R-free 0.250
1QU1 CRYSTAL STRUCTURE OF EHA2 (23-185) Deposited 1999-07-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain D 376–530（155 aa） Chain E 376–530（155 aa） Chain F 376–530（155 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.4；2% PEG 4000, 30-150 MM NACL, pH 4.40	Resolution 1.90 Å R-free 0.250
2HMG REFINEMENT OF THE INFLUENZA VIRUS HEMAGGLUTININ BY SIMULATED ANNEALING Deposited 1989-09-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
2VIR INFLUENZA VIRUS HEMAGGLUTININ COMPLEXED WITH A NEUTRALIZING ANTIBODY Deposited 1997-12-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 44–325（282 aa） Fragment：;PROTEOLYTIC FRAGMENT "HA TOP" CONTAINING HA1 RESIDUES 28 - 328 ;	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.25 Å R-free 0.249
2VIS INFLUENZA VIRUS HEMAGGLUTININ, (ESCAPE) MUTANT WITH THR 131 REPLACED BY ILE, COMPLEXED WITH A NEUTRALIZING ANTIBODY Deposited 1997-12-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 44–325（282 aa） Fragment：;PROTEOLYTIC FRAGMENT "HA TOP" CONTAINING HA1 RESIDUES 28 - 328 ;	Mutation：T131I	ZN ZINC ION × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.25 Å R-free 0.267
2VIT INFLUENZA VIRUS HEMAGGLUTININ, MUTANT WITH THR 155 REPLACED BY ILE, COMPLEXED WITH A NEUTRALIZING ANTIBODY Deposited 1997-12-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 44–325（282 aa） Fragment：;PROTEOLYTIC FRAGMENT "HA TOP" CONTAINING HA1 RESIDUES 28 - 328 ;	Mutation：T155I	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.25 Å R-free 0.237
2VIU INFLUENZA VIRUS HEMAGGLUTININ Deposited 1997-12-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa）	Mutation：CHAIN A, T131I Mutation：CHAIN A, T131I	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.242
2YPG Haemagglutinin of 1968 Human H3N2 Virus in Complex with Human Receptor Analogue LSTc Deposited 2012-10-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Fragment：HA2 OF BROMELAIN RELEASED ECTODOMAIN, RESIDUES 346-520 Chain C 17–344（328 aa） Chain D 346–520（175 aa） Fragment：HA2 OF BROMELAIN RELEASED ECTODOMAIN, RESIDUES 346-520 Chain E 17–344（328 aa） Chain F 346–520（175 aa） Fragment：HA2 OF BROMELAIN RELEASED ECTODOMAIN, RESIDUES 346-520	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 FLC CITRATE ANION × 13	X-RAY DIFFRACTION X-ray crystallization conditions 1.7-2 M TRIAMMONIUM CITRATE PH 6.5	Resolution 2.85 Å R-free 0.190
3EYM Structure of Influenza Haemagglutinin in complex with an inhibitor of membrane fusion Deposited 2008-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 25–345（321 aa） Chain B 346–517（172 aa） Chain C 25–345（321 aa） Chain D 346–517（172 aa） Chain E 25–345（321 aa） Chain F 346–517（172 aa）	Not recorded	EYK 2-tert-butylbenzene-1,4-diol × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293 K；Ammonium citratre, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.80 Å R-free 0.217
3HMG REFINEMENT OF THE INFLUENZA VIRUS HEMAGGLUTININ BY SIMULATED ANNEALING Deposited 1989-09-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
3VUN Crystal structure of a influenza A virus (A/Aichi/2/1968 H3N2) hemagglutinin in C2 space group. Deposited 2012-07-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–345（329 aa） Chain B 346–520（175 aa） Chain C 17–345（329 aa） Chain D 346–520（175 aa） Chain E 17–345（329 aa） Chain F 346–520（175 aa）	Mutation：G144S, I182V Mutation：E132D Mutation：G144S, I182V Mutation：E132D Mutation：G144S, I182V Mutation：E132D	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.25；293 K；0.2M imidazole (pH 7.0), 27% Jeffamine ED-2001 (pH 7.0), VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.00 Å R-free 0.275
3ZTJ Structure of influenza A neutralizing antibody selected from cultures of single human plasma cells in complex with human H3 Influenza haemagglutinin. Deposited 2011-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 17–345（329 aa） Chain B 346–520（175 aa） Fragment：RESIDUES 346-520 Chain C 17–345（329 aa） Chain D 346–520（175 aa） Fragment：RESIDUES 346-520 Chain E 17–345（329 aa） Chain F 346–520（175 aa） Fragment：RESIDUES 346-520	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.41 Å R-free 0.284
4HMG REFINEMENT OF THE INFLUENZA VIRUS HEMAGGLUTININ BY SIMULATED ANNEALING Deposited 1989-09-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	SIA N-acetyl-alpha-neuraminic acid × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å
5HMG REFINEMENT OF THE INFLUENZA VIRUS HEMAGGLUTININ BY SIMULATED ANNEALING Deposited 1989-09-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 17–344（328 aa） Chain B 346–520（175 aa） Chain C 17–344（328 aa） Chain D 346–520（175 aa） Chain E 17–344（328 aa） Chain F 346–520（175 aa）	Not recorded	SIA N-acetyl-alpha-neuraminic acid × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.20 Å
5Y2L Crystal structure of a group 2 HA binding antibody AF4H1K1 Fab in complex with the 1968 H3N2 pandemic (H3-AC/68) hemagglutinin Deposited 2017-07-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 17–345（329 aa） Chain B 346–521（176 aa） Fragment：UNP residues 346-521	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；0.19 mM CYMAL7, 0.1M HEPES pH 7.5, 40% ployethylene glycol 400	Resolution 2.90 Å R-free 0.244
6E56 Human antibody H2214 in complex with influenza hemagglutinin A/Aichi/2/1968 (X-31) (H3N2) Deposited 2018-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 53–335（283 aa） Fragment：head domain (UNP residues 53-335)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；291.15 K；100 mM sodium chloride, 100 mM sodium acetate, pH 5.0, 20% w/v PEG2000 MME	Resolution 2.00 Å R-free 0.214
6E56 Human antibody H2214 in complex with influenza hemagglutinin A/Aichi/2/1968 (X-31) (H3N2) Deposited 2018-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 53–335（283 aa） Fragment：head domain (UNP residues 53-335)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；291.15 K；100 mM sodium chloride, 100 mM sodium acetate, pH 5.0, 20% w/v PEG2000 MME	Resolution 2.00 Å R-free 0.214
6N5D Broadly protective antibodies directed to a subdominant influenza hemagglutinin epitope Deposited 2018-11-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 53–334（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.2 M sodium bromide, 0.1 M Bis-Tris propane, pH 6.5, 20% w/v PEG3350	Resolution 3.00 Å R-free 0.244
6N5D Broadly protective antibodies directed to a subdominant influenza hemagglutinin epitope Deposited 2018-11-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 53–334（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.2 M sodium bromide, 0.1 M Bis-Tris propane, pH 6.5, 20% w/v PEG3350	Resolution 3.00 Å R-free 0.244
6N5D Broadly protective antibodies directed to a subdominant influenza hemagglutinin epitope Deposited 2018-11-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 53–334（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.2 M sodium bromide, 0.1 M Bis-Tris propane, pH 6.5, 20% w/v PEG3350	Resolution 3.00 Å R-free 0.244
6N5E Broadly protective antibodies directed to a subdominant influenza hemagglutinin epitope Deposited 2018-11-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 53–334（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.2 M ammonium sulfate, 0.1 M MES, pH 6.5, 20% w/v PEG8000	Resolution 3.00 Å R-free 0.287
6N5E Broadly protective antibodies directed to a subdominant influenza hemagglutinin epitope Deposited 2018-11-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 53–334（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.2 M ammonium sulfate, 0.1 M MES, pH 6.5, 20% w/v PEG8000	Resolution 3.00 Å R-free 0.287
6N5E Broadly protective antibodies directed to a subdominant influenza hemagglutinin epitope Deposited 2018-11-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 53–334（282 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；291 K；0.2 M ammonium sulfate, 0.1 M MES, pH 6.5, 20% w/v PEG8000	Resolution 3.00 Å R-free 0.287
6XPX Human antibody S1V2-51 in complex with the influenza hemagglutinin head domain of A/Aichi/2/1968 (X-31)(H3N2) Deposited 2020-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 53–335（283 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 BCN BICINE × 2 GOL GLYCEROL × 7 1PE PENTAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；291.15 K；0.3 M Magnesium chloride, 25% (w/v) PEG 2000, 15% (w/v) Glycerol, 0.1 M BICINE, pH 9.0	Resolution 2.60 Å R-free 0.215
6Y5G Ectodomain of X-31 Haemagglutinin at pH 8 Deposited 2020-02-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 24–341（318 aa） Chain B 346–517（172 aa） Chain C 24–341（318 aa） Chain D 346–517（172 aa） Chain E 24–341（318 aa） Chain F 346–517（172 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
6Y5H Ectodomain of X-31 Haemagglutinin at pH 5 (State I) Deposited 2020-02-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 24–341（318 aa） Chain B 346–517（172 aa） Chain C 24–341（318 aa） Chain D 346–517（172 aa） Chain E 24–341（318 aa） Chain F 346–517（172 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
6Y5I Dilated form 1 of X-31 Influenza Haemagglutinin at pH 5 (State II) Deposited 2020-02-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 24–341（318 aa） Chain B 346–517（172 aa） Chain C 24–341（318 aa） Chain D 346–517（172 aa） Chain E 24–341（318 aa） Chain F 346–517（172 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.50 Å
6Y5J Dilated form 2 of X-31 Influenza Haemagglutinin at pH 5 (State III) Deposited 2020-02-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 24–341（318 aa） Chain B 346–517（172 aa） Chain C 24–341（318 aa） Chain D 346–517（172 aa） Chain E 24–341（318 aa） Chain F 346–517（172 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.60 Å
6Y5K Extended Intermediate form of X-31 Influenza Haemagglutinin at pH 5 (State IV) Deposited 2020-02-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 24–341（318 aa） Chain B 346–517（172 aa） Chain C 24–341（318 aa） Chain D 346–517（172 aa） Chain E 24–341（318 aa） Chain F 346–517（172 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.20 Å
6Y5L Signal Subtracted Extended Intermediate form of X-31 Influenza Haemagglutinin at pH 5 (State IV) Deposited 2020-02-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 346–517（172 aa） Chain D 346–517（172 aa） Chain F 346–517（172 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7ZJ6 X-31 Hemagglutinin Precursor HA0 at pH 7.5 Deposited 2022-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 17–520（504 aa） Chain B 17–520（504 aa） Chain C 17–520（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；4s blot	Resolution 2.60 Å
7ZJ7 X-31 Hemagglutinin Precursor HA0 at pH 4.8 Deposited 2022-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 17–520（504 aa） Chain B 17–520（504 aa） Chain C 17–520（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 4.8 cryo-EM vitrification conditions Cryogen ETHANE；4s blot	Resolution 3.95 Å
7ZJ8 X-31 Hemagglutinin Precursor HA0 at pH 7.5 after reneutralization Deposited 2022-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 17–520（504 aa） Chain B 17–520（504 aa） Chain C 17–520（504 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 BOG octyl beta-D-glucopyranoside × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE；4s blot	Resolution 3.10 Å
8G5B Influenza A H3N2 X-31 Hemagglutinin in complex with FL-1061 Deposited 2023-02-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 53–335（283 aa） Fragment：head fragment	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8PK3 CryoEM reconstruction of hemagglutinin HK68 of Influenza A virus bound to an Affimer reagent Deposited 2023-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 9 PDB declaration: nonameric	Chain D 346–520（175 aa） Chain E 346–520（175 aa） Chain F 346–520（175 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å

42 other PDB entries and 48 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HEMA_IAAIC
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–328； UniProt 17–344 Author chain B； PDBConstruct 1–175； UniProt 346–520

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1qfu
Deposition date deposition_date	1999-04-14
Structure title title	INFLUENZA VIRUS HEMAGGLUTININ COMPLEXED WITH A NEUTRALIZING ANTIBODY
Keywords keywords	COMPLEX (HEMAGGLUTININ-IMMMUNOGLOBULIN), HEMAGGLUTININ, IMMUNOGLOBULIN, Viral protein-Immune system COMPLEX; Viral protein/Immune system
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	42.00 Å
Radius of gyration Rg (electron density) rg_electron	42.18 Å
Forward intensity I(0) i0	175542000.00
Molecular weight molecular_weight	104760.0 kDa
Excluded volume excluded_volume	130070 Å³
Envelope volume envelope_volume	176480 Å³
Hydration-shell volume shell_volume	40114 Å³
Envelope diameter envelope_diameter	158.5 Å
Shell Rg shell_rg	40.57 Å
Envelope Rg envelope_rg	42.29 Å
Shape Rg shape_rg	42.16 Å
Total Rg total_rg	42.15 Å
Total atoms total_atoms	7369
Residues n_residues	917
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	151.2 Å
Rg (real space) rg_real	42.58 Å
Rg uncertainty (real space) rg_real_error	1.86 Å
I(0) (real space) i0_real	1.7550e+08
I(0) uncertainty (real space) i0_real_error	3.3100e+06
Rg (reciprocal space) rg_reciprocal	42.01 Å
I(0) (reciprocal space) i0_reciprocal	175400000.0000
Solution quality estimate total_estimate	0.7828
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	39.8 Å
Skewness Skewness skewness	0.669
Kurtosis Kurtosis kurtosis	-0.051
Angular range angular_range	— – 0.1900 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	9532000.0000
Real-space data points n_real_points	39
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.656; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.675; Smooth: 0.530

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	PROTEIN (HEMAGGLUTININ (HA1 CHAIN))
Molecular weight formula_weight	36065.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	7439

QDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGIHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQT

Entity 2 Entity 2 polymer

Description description	PROTEIN (HEMAGGLUTININ (HA2 CHAIN))
Molecular weight formula_weight	20212.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKG

Entity 3 Entity 3 polymer

Description description	PROTEIN (IMMUNOGLOBULIN IGG1-KAPPA ANTIBODY (LIGHT CHAIN))
Molecular weight formula_weight	23980.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

DVVMTQTPLSLPVSLGDQASISCRSSQTLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQNTHVPYTFGGGTKLEIKRADAAPTVSIFPPSKIQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN

Entity 4 Entity 4 polymer

Description description	PROTEIN (IMMUNOGLOBULIN IGG1-KAPPA ANTIBODY (HEAVY CHAIN))
Molecular weight formula_weight	24426.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

QVQLQQPGAELVRPGASVKLSCKASGYTLTTYWMNWFKQRPDQGLEWIGRIDPYDSETHYNQKFKDKAILTVDRSSSTAYMQLSSLTSEDSAVYYCTRFLQITTIIYGMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD

Entity 5 Entity 5 branched

Description description	2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	1

Entity 6 Entity 6 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	3

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	70

▼

7. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (7 domains)

Domain ID domain_id	d1qfua_
Class class	b — All beta proteins
Fold Fold fold	b.19 — Viral protein domain
Superfamily Superfamily superfamily	b.19.1 — Viral protein domain
Family Family family	b.19.1.2 — Influenza hemagglutinin headpiece

Domain ID domain_id	d1qfub_
Class class	h — Coiled coil proteins
Fold Fold fold	h.3 — Stalk segment of viral fusion proteins
Superfamily Superfamily superfamily	h.3.1 — Influenza hemagglutinin (stalk)
Family Family family	h.3.1.1 — Influenza hemagglutinin (stalk)

Domain ID domain_id	d1qfuh1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d1qfuh2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

Domain ID domain_id	d1qfuh3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1qful1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.1 — V set domains (antibody variable domain-like)

Domain ID domain_id	d1qful2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.1 — Immunoglobulin
Family Family family	b.1.1.2 — C1 set domains (antibody constant domain-like)

CATH v4.4 (7 domains)

Domain ID domain_id	1qfuA01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	209 — Hemagglutinin (Ha1 Chain); Chain: A; domain 1
Homologous superfamily homologous superfamily	20 — Haemagglutinin, alpha/beta domain, HA1 chain

Domain ID domain_id	1qfuA02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	77 — Hemagglutinin; Chain A, domain 2
Homologous superfamily homologous superfamily	10 — Hemagglutinin Chain A, Domain 2

Domain ID domain_id	1qfuB00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	20 — Hemagglutinin Ectodomain; Chain B
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1qfuH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1qfuH02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1qfuL01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1qfuL02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (4)

▶

Unit-cell length a length_a	138.000 Å
Unit-cell length b length_b	138.000 Å
Unit-cell length c length_c	135.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 3 2 1
Space-group number int_tables_number	150
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	7.000 Å
R factor r_factor	—
R_work r_work	0.1980
R_free r_free	0.2840

fit	/app/data/saxs_computation/qf/1qfu/1qfu.fit
pddf	/app/data/pr_computation/qf/1qfu/1qfu.pr.out
profile	/app/data/saxs_computation/qf/1qfu/1qfu.dat

INFLUENZA VIRUS HEMAGGLUTININ COMPLEXED WITH A NEUTRALIZING ANTIBODY

1. Protein Identity and Related Structures Protein Identity & Related Structures

PROTEIN (HEMAGGLUTININ (HA1 CHAIN))

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 branched

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (7 domains)

CATH v4.4 (7 domains)

8. Citations (4)

9. Files and Curves (10)

Files (7)

Curves (3)