1t6b

Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor

Method: X-RAY DIFFRACTION D_max: 132.8 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protective Antigen

Bacillus anthracis

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain X； UniProt 30–764	Not recorded	Anthrax toxin receptor 2 × 1 （P58335） CA CALCIUM ION × 2 NA SODIUM ION × 2 PG4 TETRAETHYLENE GLYCOL × 1 MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 9；300 K；CHES buffer, PEG400, pH 9.0, VAPOR DIFFUSION, SITTING DROP, temperature 300K	Resolution 2.50 Å R-free 0.266

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1T6B	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1ACC ANTHRAX PROTECTIVE ANTIGEN Deposited 1997-02-05	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；277 K；PROTEIN WAS CRYSTALLIZED FROM 12-18% PEG 8K AND 50 MM CITRATE, PH 6.0 AT 4 DEGREES C. CRYSTAL FORM ""2"" (NEEDLE-LIKE CRYSTALS)., temperature 277K	Resolution 2.10 Å R-free 0.296
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 203–764（562 aa） Fragment：63-kDa domain Chain B 203–764（562 aa） Fragment：63-kDa domain Chain C 203–764（562 aa） Fragment：63-kDa domain Chain D 203–764（562 aa） Fragment：63-kDa domain Chain E 203–764（562 aa） Fragment：63-kDa domain Chain F 203–764（562 aa） Fragment：63-kDa domain Chain O 203–764（562 aa） Fragment：63-kDa domain	Not recorded	CA CALCIUM ION × 14 MG MAGNESIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain G 203–764（562 aa） Fragment：63-kDa domain Chain H 203–764（562 aa） Fragment：63-kDa domain Chain I 203–764（562 aa） Fragment：63-kDa domain Chain J 203–764（562 aa） Fragment：63-kDa domain Chain K 203–764（562 aa） Fragment：63-kDa domain Chain L 203–764（562 aa） Fragment：63-kDa domain Chain M 203–764（562 aa） Fragment：63-kDa domain	Not recorded	CA CALCIUM ION × 14 MG MAGNESIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain A 203–764（562 aa） Fragment：63-kDa domain Chain B 203–764（562 aa） Fragment：63-kDa domain Chain C 203–764（562 aa） Fragment：63-kDa domain Chain D 203–764（562 aa） Fragment：63-kDa domain Chain E 203–764（562 aa） Fragment：63-kDa domain Chain F 203–764（562 aa） Fragment：63-kDa domain Chain G 203–764（562 aa） Fragment：63-kDa domain Chain H 203–764（562 aa） Fragment：63-kDa domain Chain I 203–764（562 aa） Fragment：63-kDa domain Chain J 203–764（562 aa） Fragment：63-kDa domain Chain K 203–764（562 aa） Fragment：63-kDa domain Chain L 203–764（562 aa） Fragment：63-kDa domain Chain M 203–764（562 aa） Fragment：63-kDa domain Chain O 203–764（562 aa） Fragment：63-kDa domain	Not recorded	CA CALCIUM ION × 28 MG MAGNESIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain A 203–764（562 aa） Fragment：63-kDa domain Chain B 203–764（562 aa） Fragment：63-kDa domain Chain C 203–764（562 aa） Fragment：63-kDa domain Chain D 203–764（562 aa） Fragment：63-kDa domain Chain E 203–764（562 aa） Fragment：63-kDa domain Chain F 203–764（562 aa） Fragment：63-kDa domain Chain G 203–764（562 aa） Fragment：63-kDa domain Chain H 203–764（562 aa） Fragment：63-kDa domain Chain I 203–764（562 aa） Fragment：63-kDa domain Chain J 203–764（562 aa） Fragment：63-kDa domain Chain K 203–764（562 aa） Fragment：63-kDa domain Chain L 203–764（562 aa） Fragment：63-kDa domain Chain M 203–764（562 aa） Fragment：63-kDa domain Chain O 203–764（562 aa） Fragment：63-kDa domain	Not recorded	CA CALCIUM ION × 28 MG MAGNESIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain A 203–764（562 aa） Fragment：63-kDa domain Chain B 203–764（562 aa） Fragment：63-kDa domain Chain C 203–764（562 aa） Fragment：63-kDa domain Chain D 203–764（562 aa） Fragment：63-kDa domain Chain E 203–764（562 aa） Fragment：63-kDa domain Chain F 203–764（562 aa） Fragment：63-kDa domain Chain G 203–764（562 aa） Fragment：63-kDa domain Chain H 203–764（562 aa） Fragment：63-kDa domain Chain I 203–764（562 aa） Fragment：63-kDa domain Chain J 203–764（562 aa） Fragment：63-kDa domain Chain K 203–764（562 aa） Fragment：63-kDa domain Chain L 203–764（562 aa） Fragment：63-kDa domain Chain M 203–764（562 aa） Fragment：63-kDa domain Chain O 203–764（562 aa） Fragment：63-kDa domain	Not recorded	CA CALCIUM ION × 28 MG MAGNESIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZO Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 203–764（562 aa） Fragment：63-kDa domain Chain B 203–764（562 aa） Fragment：63-kDa domain Chain C 203–764（562 aa） Fragment：63-kDa domain Chain D 203–764（562 aa） Fragment：63-kDa domain Chain E 203–764（562 aa） Fragment：63-kDa domain Chain F 203–764（562 aa） Fragment：63-kDa domain Chain O 203–764（562 aa） Fragment：63-kDa domain	Not recorded	CA CALCIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；HEPES, sodium chloride, b-octylglucoside, spermine, pH 8.25, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.60 Å R-free 0.317
1TZO Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain G 203–764（562 aa） Fragment：63-kDa domain Chain H 203–764（562 aa） Fragment：63-kDa domain Chain I 203–764（562 aa） Fragment：63-kDa domain Chain J 203–764（562 aa） Fragment：63-kDa domain Chain K 203–764（562 aa） Fragment：63-kDa domain Chain L 203–764（562 aa） Fragment：63-kDa domain Chain M 203–764（562 aa） Fragment：63-kDa domain	Not recorded	CA CALCIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.25；298 K；HEPES, sodium chloride, b-octylglucoside, spermine, pH 8.25, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.60 Å R-free 0.317
25PV Structure of the anthrax protective antigen in complex with a potent neutralizing antibody Deposited 2026-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 200–626（427 aa）	Mutation：F231S	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.03 Å
3ETB Crystal structure of the engineered neutralizing antibody M18 complexed with anthrax protective antigen domain 4 Deposited 2008-10-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 621–764（144 aa） Fragment：Domain 4 of protective antigen PA-63: UNP residues 621-764	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；10% PEG 20000, 0.05 M Tris-HCl, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.80 Å R-free 0.276
3ETB Crystal structure of the engineered neutralizing antibody M18 complexed with anthrax protective antigen domain 4 Deposited 2008-10-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 621–764（144 aa） Fragment：Domain 4 of protective antigen PA-63: UNP residues 621-764	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；10% PEG 20000, 0.05 M Tris-HCl, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.80 Å R-free 0.276
3ETB Crystal structure of the engineered neutralizing antibody M18 complexed with anthrax protective antigen domain 4 Deposited 2008-10-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 621–764（144 aa） Fragment：Domain 4 of protective antigen PA-63: UNP residues 621-764	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；10% PEG 20000, 0.05 M Tris-HCl, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.80 Å R-free 0.276
3ETB Crystal structure of the engineered neutralizing antibody M18 complexed with anthrax protective antigen domain 4 Deposited 2008-10-07	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 621–764（144 aa） Fragment：Domain 4 of protective antigen PA-63: UNP residues 621-764	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；10% PEG 20000, 0.05 M Tris-HCl, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 3.80 Å R-free 0.276
3INO 1.95A Resolution Structure of Protective Antigen Domain 4 Deposited 2009-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 624–764（141 aa） Fragment：Domain 4 Chain B 624–764（141 aa） Fragment：Domain 4	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；277 K；20% PEG 8000, 100mM imidazole, 3% MPD, pH 6.5, vapor diffusion, temperature 277K	Resolution 1.95 Å R-free 0.258
3INO 1.95A Resolution Structure of Protective Antigen Domain 4 Deposited 2009-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 624–764（141 aa） Fragment：Domain 4	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；277 K；20% PEG 8000, 100mM imidazole, 3% MPD, pH 6.5, vapor diffusion, temperature 277K	Resolution 1.95 Å R-free 0.258
3INO 1.95A Resolution Structure of Protective Antigen Domain 4 Deposited 2009-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 624–764（141 aa） Fragment：Domain 4	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；277 K；20% PEG 8000, 100mM imidazole, 3% MPD, pH 6.5, vapor diffusion, temperature 277K	Resolution 1.95 Å R-free 0.258
3J9C CryoEM single particle reconstruction of anthrax toxin protective antigen pore at 2.9 Angstrom resolution Deposited 2014-12-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: 7-MERIC	Chain A 203–764（562 aa） Fragment：C-terminal 63-kDa fragment (UNP residues 203-764)	Not recorded	CA CALCIUM ION × 14	ELECTRON MICROSCOPY cryo-EM buffer 50 mM NaOAc, pH 5.0, 0.05% Igepal CA-630；pH 5；50 mM NaOAc, pH 5.0, 0.05% Igepal CA-630 cryo-EM vitrification conditions Cryogen ETHANE；Plunged into liguid nitrogen (FEI VITROBOT MARK IV).	Resolution 2.90 Å
3J9C CryoEM single particle reconstruction of anthrax toxin protective antigen pore at 2.9 Angstrom resolution Deposited 2014-12-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 203–764（562 aa） Fragment：C-terminal 63-kDa fragment (UNP residues 203-764)	Not recorded	CA CALCIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 50 mM NaOAc, pH 5.0, 0.05% Igepal CA-630；pH 5；50 mM NaOAc, pH 5.0, 0.05% Igepal CA-630 cryo-EM vitrification conditions Cryogen ETHANE；Plunged into liguid nitrogen (FEI VITROBOT MARK IV).	Resolution 2.90 Å
3J9C CryoEM single particle reconstruction of anthrax toxin protective antigen pore at 2.9 Angstrom resolution Deposited 2014-12-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 203–764（562 aa） Fragment：C-terminal 63-kDa fragment (UNP residues 203-764)	Not recorded	CA CALCIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer 50 mM NaOAc, pH 5.0, 0.05% Igepal CA-630；pH 5；50 mM NaOAc, pH 5.0, 0.05% Igepal CA-630 cryo-EM vitrification conditions Cryogen ETHANE；Plunged into liguid nitrogen (FEI VITROBOT MARK IV).	Resolution 2.90 Å
3KWV Structural basis for the unfolding of anthrax lethal factor by protective antigen oligomers Deposited 2009-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 197–764（568 aa） Fragment：UNP residues 197-764 Chain B 197–764（568 aa） Fragment：UNP residues 197-764	Mutation：V303P, H304G Mutation：V303P, H304G	CA CALCIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；291 K；16% PEG 3000, 0.1M cacodylic acid, 0.2M magnesium chloride, 10 mM Tris-Cl, 75 mM sodium chloride, 10 mM adenosine-5'-triphosphate, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.10 Å R-free 0.281
3KWV Structural basis for the unfolding of anthrax lethal factor by protective antigen oligomers Deposited 2009-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain D 197–764（568 aa） Fragment：UNP residues 197-764 Chain E 197–764（568 aa） Fragment：UNP residues 197-764	Mutation：V303P, H304G Mutation：V303P, H304G	CA CALCIUM ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；291 K；16% PEG 3000, 0.1M cacodylic acid, 0.2M magnesium chloride, 10 mM Tris-Cl, 75 mM sodium chloride, 10 mM adenosine-5'-triphosphate, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 3.10 Å R-free 0.281
3MHZ 1.7A structure of 2-fluorohistidine labeled Protective Antigen Deposited 2010-04-09	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 PG4 TETRAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.2；293 K；30% PEG 400, 0.1M Tris, pH 8.2, vapor diffusion, temperature 293K	Resolution 1.70 Å R-free 0.222
3Q8A Crystal structure of WT Protective Antigen (pH 5.5) Deposited 2011-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；293 K；25 %(w/v) PEG 1500, 100 mM SPG Buffer, pH 5.5, vapor diffusion, temperature 293K	Resolution 3.13 Å R-free 0.279
3Q8B Crystal structure of WT Protective Antigen (pH 9.0) Deposited 2011-01-06	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 9；293 K；25 %(w/v) PEG 1500, 100 mM MMT Buffer, pH 9.0, vapor diffusion, temperature 293K	Resolution 2.00 Å R-free 0.258
3Q8C Crystal structure of Protective Antigen W346F (pH 5.5) Deposited 2011-01-06	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa）	Mutation：W346F	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.5；293 K；25%(w/v) PEG 1500, 100mM SPG Buffer, pH 5.5, vapor diffusion, temperature 293K	Resolution 2.85 Å R-free 0.271
3Q8E Crystal structure of Protective Antigen W346F (pH 8.5) Deposited 2011-01-06	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa）	Mutation：W346F	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293 K；25%(w/v) PEG 1500, 100mM SPG Buffer, pH 8.5, vapor diffusion, temperature 293K	Resolution 2.10 Å R-free 0.248
3Q8F Crystal structure of 2-Fluorohistine labeled Protective Antigen (pH 5.8) Deposited 2011-01-06	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2 PG4 TETRAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293 K；30% PEG 400, 100mM MES, pH 7.0, vapor diffusion, temperature 293K	Resolution 2.10 Å R-free 0.267
3TEZ Crystal Structure of Anthrax Protective Antigen Mutant S337C N664C and dithiolacetone modified to 1.8-A resolution Deposited 2011-08-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa）	Mutation：S337C,N664C	CA CALCIUM ION × 2 MXE 2-METHOXYETHANOL × 2 ACN ACETONE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；292 K；20% PEG-ME 2000, 0.1M Tris-Cl, 0.2M Trimethylamine-N-oxide, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 292K	Resolution 1.83 Å R-free 0.226
4EE2 Crystal Structure of Anthrax Protective Antigen K446M Mutant to 1.91-A Resolution Deposited 2012-03-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa） Fragment：Protective antigen	Mutation：K446M	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；292 K；0.1M tris, 20% peg2k-MME, 0.2M TMAO, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 292K	Resolution 1.91 Å R-free 0.265
4H2A Crystal structure of wild type protective antigen to 1.62 A (pH 7.5) Deposited 2012-09-12	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 4 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；280 K；protein crystallised from 0.1 M HEPES pH 7.5, 10 % PEG 8000, 8 % ethylene glycol by sitting drop vapour diffusion at temperature 280 K., VAPOR DIFFUSION, SITTING DROP	Resolution 1.62 Å R-free 0.219
4NAM 1.7A structure of 5-Fluoro Tryptophan Labeled Protective Antigen (W206Y) Deposited 2013-10-22	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 30–764（735 aa）	Mutation：W206Y Non-standard monomer：Yes (specific site not provided by mmCIF)	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；293 K；35% (v/v) Pentaerythritol propoxylate (5/4 PO/OH), 0.05 M HEPES, 0.2 M Potassium chloride, pH 7.5, vapor diffusion, temperature 293K	Resolution 1.70 Å R-free 0.208
5FR3 X-ray crystal structure of aggregation-resistant protective antigen of Bacillus anthracis (mutant S559L T576E) Deposited 2015-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 43–764（722 aa）	Mutation：YES	CA CALCIUM ION × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions 20 MM MGCL2, 100 MM HEPES PH 7.5, 22% POLY(ACRYLIC ACID SODIUM SALT) 5100	Resolution 1.94 Å R-free 0.227
6PSN Anthrax toxin protective antigen channels bound to lethal factor Deposited 2019-07-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 197–764（568 aa） Chain B 197–764（568 aa） Chain C 197–764（568 aa） Chain D 197–764（568 aa） Chain E 197–764（568 aa） Chain F 197–764（568 aa） Chain G 197–764（568 aa）	Not recorded	CA CALCIUM ION × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
6UJI Low resolution crystal structure (5.5 A) of the anthrax toxin protective antigen heptamer prepore D425A mutant Deposited 2019-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain A 197–764（568 aa） Chain B 197–764（568 aa） Chain C 197–764（568 aa） Chain D 197–764（568 aa） Chain E 197–764（568 aa） Chain F 197–764（568 aa） Chain G 197–764（568 aa）	Mutation：D425A Mutation：D425A Mutation：D425A Mutation：D425A Mutation：D425A Mutation：D425A Mutation：D425A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；291 K；10% (v/v) ethanol, 0.1 M Tris	Resolution 5.50 Å R-free 0.278
6UJI Low resolution crystal structure (5.5 A) of the anthrax toxin protective antigen heptamer prepore D425A mutant Deposited 2019-10-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 7 PDB declaration: heptameric	Chain H 197–764（568 aa） Chain I 197–764（568 aa） Chain J 197–764（568 aa） Chain K 197–764（568 aa） Chain L 197–764（568 aa） Chain M 197–764（568 aa） Chain N 197–764（568 aa）	Mutation：D425A Mutation：D425A Mutation：D425A Mutation：D425A Mutation：D425A Mutation：D425A Mutation：D425A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；291 K；10% (v/v) ethanol, 0.1 M Tris	Resolution 5.50 Å R-free 0.278
6UZB Anthrax toxin protective antigen channels bound to edema factor Deposited 2019-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 30–764（735 aa） Chain B 30–764（735 aa） Chain C 30–764（735 aa） Chain D 30–764（735 aa） Chain E 30–764（735 aa） Chain F 30–764（735 aa） Chain G 30–764（735 aa）	Not recorded	CA CALCIUM ION × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
6UZD Anthrax toxin protective antigen channels bound to edema factor Deposited 2019-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 30–764（735 aa） Chain B 30–764（735 aa） Chain C 30–764（735 aa） Chain D 30–764（735 aa） Chain E 30–764（735 aa） Chain F 30–764（735 aa） Chain G 30–764（735 aa）	Not recorded	CA CALCIUM ION × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6UZE Anthrax toxin protective antigen channels bound to edema factor Deposited 2019-11-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 30–764（735 aa） Chain B 30–764（735 aa） Chain C 30–764（735 aa） Chain D 30–764（735 aa） Chain E 30–764（735 aa） Chain F 30–764（735 aa） Chain G 30–764（735 aa）	Not recorded	CA CALCIUM ION × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
6VRA Anthrax octamer prechannel bound to full-length edema factor Deposited 2020-02-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 33–764（732 aa） Chain B 33–764（732 aa） Chain C 33–764（732 aa） Chain D 33–764（732 aa） Chain E 33–764（732 aa） Chain F 33–764（732 aa） Chain G 33–764（732 aa） Chain H 33–764（732 aa）	Mutation：K245G, R252N Mutation：D512K Mutation：K245G, R252N Mutation：D512K Mutation：K245G, R252N Mutation：D512K Mutation：K245G, R252N Mutation：D512K	CA CALCIUM ION × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
6WJJ Anthrax octamer prechannel bound to full-length lethal factor Deposited 2020-04-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 33–764（732 aa） Chain B 33–764（732 aa） Chain C 33–764（732 aa） Chain D 33–764（732 aa） Chain E 33–764（732 aa） Chain F 33–764（732 aa） Chain G 33–764（732 aa） Chain H 33–764（732 aa）	Not recorded	CA CALCIUM ION × 16 SO4 SULFATE ION × 4 ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7KXR Protective antigen pore translocating lethal factor N-terminal domain Deposited 2020-12-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 203–764（562 aa） Fragment：UNP Residues 203-764 Chain B 203–764（562 aa） Fragment：UNP Residues 203-764 Chain C 203–764（562 aa） Fragment：UNP Residues 203-764 Chain D 203–764（562 aa） Fragment：UNP Residues 203-764 Chain E 203–764（562 aa） Fragment：UNP Residues 203-764 Chain F 203–764（562 aa） Fragment：UNP Residues 203-764 Chain G 203–764（562 aa） Fragment：UNP Residues 203-764	Not recorded	CA CALCIUM ION × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 5.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7O85 Anthrax toxin prepore in complex with the neutralizing Fab cAb29 Deposited 2021-04-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 21 PDB declaration: 21-meric	Chain A 203–643（441 aa） Chain D 203–643（441 aa） Chain G 203–643（441 aa） Chain J 203–643（441 aa） Chain M 203–643（441 aa） Chain P 203–643（441 aa） Chain S 203–643（441 aa）	Not recorded	CA CALCIUM ION × 14	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å

28 other PDB entries and 42 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PAG_BACAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain X； PDBConstruct 1–735； UniProt 30–764

Anthrax toxin receptor 2

Homo sapiens

UniProt P58335

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain Y； UniProt 35–212	Fragment：A/I domain	Protective Antigen × 1 （P13423） CA CALCIUM ION × 2 NA SODIUM ION × 2 PG4 TETRAETHYLENE GLYCOL × 1 MN MANGANESE (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 9；300 K；CHES buffer, PEG400, pH 9.0, VAPOR DIFFUSION, SITTING DROP, temperature 300K	Resolution 2.50 Å R-free 0.266

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 1T6B	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1SHT Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor Deposited 2004-02-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 38–217（180 aa） Fragment：VWA domain	Not recorded	ACT ACETATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；PEG8K, magnesium acetate, sodium cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.81 Å R-free 0.186
1SHU Crystal Structure of the von Willebrand factor A domain of human capillary morphogenesis protein 2: an anthrax toxin receptor Deposited 2004-02-26	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 38–218（181 aa） Fragment：VWA domain	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；PEG3350, magnesium chloride, bis-tris, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.215
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain a 38–218（181 aa） Fragment：VWA domain Chain b 38–218（181 aa） Fragment：VWA domain Chain c 38–218（181 aa） Fragment：VWA domain Chain d 38–218（181 aa） Fragment：VWA domain Chain e 38–218（181 aa） Fragment：VWA domain Chain f 38–218（181 aa） Fragment：VWA domain Chain o 38–218（181 aa） Fragment：VWA domain	Not recorded	CA CALCIUM ION × 14 MG MAGNESIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain g 38–218（181 aa） Fragment：VWA domain Chain h 38–218（181 aa） Fragment：VWA domain Chain i 38–218（181 aa） Fragment：VWA domain Chain j 38–218（181 aa） Fragment：VWA domain Chain k 38–218（181 aa） Fragment：VWA domain Chain l 38–218（181 aa） Fragment：VWA domain Chain m 38–218（181 aa） Fragment：VWA domain	Not recorded	CA CALCIUM ION × 14 MG MAGNESIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain a 38–218（181 aa） Fragment：VWA domain Chain b 38–218（181 aa） Fragment：VWA domain Chain c 38–218（181 aa） Fragment：VWA domain Chain d 38–218（181 aa） Fragment：VWA domain Chain e 38–218（181 aa） Fragment：VWA domain Chain f 38–218（181 aa） Fragment：VWA domain Chain g 38–218（181 aa） Fragment：VWA domain Chain h 38–218（181 aa） Fragment：VWA domain Chain i 38–218（181 aa） Fragment：VWA domain Chain j 38–218（181 aa） Fragment：VWA domain Chain k 38–218（181 aa） Fragment：VWA domain Chain l 38–218（181 aa） Fragment：VWA domain Chain m 38–218（181 aa） Fragment：VWA domain Chain o 38–218（181 aa） Fragment：VWA domain	Not recorded	CA CALCIUM ION × 28 MG MAGNESIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain a 38–218（181 aa） Fragment：VWA domain Chain b 38–218（181 aa） Fragment：VWA domain Chain c 38–218（181 aa） Fragment：VWA domain Chain d 38–218（181 aa） Fragment：VWA domain Chain e 38–218（181 aa） Fragment：VWA domain Chain f 38–218（181 aa） Fragment：VWA domain Chain g 38–218（181 aa） Fragment：VWA domain Chain h 38–218（181 aa） Fragment：VWA domain Chain i 38–218（181 aa） Fragment：VWA domain Chain j 38–218（181 aa） Fragment：VWA domain Chain k 38–218（181 aa） Fragment：VWA domain Chain l 38–218（181 aa） Fragment：VWA domain Chain m 38–218（181 aa） Fragment：VWA domain Chain o 38–218（181 aa） Fragment：VWA domain	Not recorded	CA CALCIUM ION × 28 MG MAGNESIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
1TZN Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor Deposited 2004-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 28 PDB declaration: 28-meric	Chain a 38–218（181 aa） Fragment：VWA domain Chain b 38–218（181 aa） Fragment：VWA domain Chain c 38–218（181 aa） Fragment：VWA domain Chain d 38–218（181 aa） Fragment：VWA domain Chain e 38–218（181 aa） Fragment：VWA domain Chain f 38–218（181 aa） Fragment：VWA domain Chain g 38–218（181 aa） Fragment：VWA domain Chain h 38–218（181 aa） Fragment：VWA domain Chain i 38–218（181 aa） Fragment：VWA domain Chain j 38–218（181 aa） Fragment：VWA domain Chain k 38–218（181 aa） Fragment：VWA domain Chain l 38–218（181 aa） Fragment：VWA domain Chain m 38–218（181 aa） Fragment：VWA domain Chain o 38–218（181 aa） Fragment：VWA domain	Not recorded	CA CALCIUM ION × 28 MG MAGNESIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG 8000, sodium chloride, Tris, magnesium chloride, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 4.30 Å R-free 0.330
7N1O The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone Deposited 2021-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–217（178 aa）	Mutation：1TEL: R41A,D46G,V112E,K122A,vWa: R49A,C175A,V112A,K112A	MG MAGNESIUM ION × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.7；298 K；100 mM BisTris, 3.0 M NaCl	Resolution 2.77 Å R-free 0.228
8FT6 The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, SUMO tag-free preparation. Deposited 2023-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–217（178 aa）	Mutation：R14A,V77E,K87A,R89A,R91A,A225V	CIT CITRIC ACID × 1 IOD IODIDE ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.2M Ammonium citrate tribasic, 20% w/v PEG 3350	Resolution 2.62 Å R-free 0.234
8FT8 The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, SUMO tag-free preparation Deposited 2023-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–217（178 aa）	Mutation：R14A,V77E,K87A,R89A,R91T,A92V,A225V	GOL GLYCEROL × 1 CL CHLORIDE ION × 3 K POTASSIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES, 2.0M ammonium sulfate	Resolution 1.60 Å R-free 0.204
8FZ4 The von Willebrand factor A domain of Anthrax toxin receptor 2 Deposited 2023-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 37–217（181 aa）	Mutation：P37G, C39A, C175A	MG MAGNESIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.5；298 K；1.2 uL of 20 mg/mL protein in 12.5 mM Tris pH 8.8, 200mM KCl, 10mM MgCl2 combined with 1.2 uL of 0.1 M Glycine pH 9.5, 24% PEG 3350	Resolution 2.19 Å R-free 0.256
8FZ4 The von Willebrand factor A domain of Anthrax toxin receptor 2 Deposited 2023-01-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 37–217（181 aa）	Mutation：P37G, C39A, C175A	MG MAGNESIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.5；298 K；1.2 uL of 20 mg/mL protein in 12.5 mM Tris pH 8.8, 200mM KCl, 10mM MgCl2 combined with 1.2 uL of 0.1 M Glycine pH 9.5, 24% PEG 3350	Resolution 2.19 Å R-free 0.256
8FZU The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, Expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 39–217（179 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES 2.0M ammonium sulfate	Resolution 1.90 Å R-free 0.266
8FZU The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, Expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 39–217（179 aa）	Not recorded	K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES 2.0M ammonium sulfate	Resolution 1.90 Å R-free 0.266
8FZU The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, Expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 39–217（179 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.1M HEPES 2.0M ammonium sulfate	Resolution 1.90 Å R-free 0.266
8FZV The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–217（178 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；100 mM sodium acetate, pH 4.6, 2.0 M sodium formate	Resolution 3.29 Å R-free 0.314
8FZV The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 40–217（178 aa）	Not recorded	UNX UNKNOWN LIGAND × 32	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；100 mM sodium acetate, pH 4.6, 2.0 M sodium formate	Resolution 3.29 Å R-free 0.314
8FZV The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Ala-Ala linker variant, expressed with SUMO tag Deposited 2023-01-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 40–217（178 aa）	Not recorded	UNX UNKNOWN LIGAND × 58	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；298 K；100 mM sodium acetate, pH 4.6, 2.0 M sodium formate	Resolution 3.29 Å R-free 0.314
9DOC The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly fused to the 1TEL crystallization chaperone, Thr-Val linker variant, at 1.2 Angstrom resolution Deposited 2024-09-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 43–217（175 aa） Fragment：von Willebrand factor A domain of CMG2	Mutation：TELSAM: R80S,V112E (Uniprot numbering),vWA: C175A (Uniprot numbering)	GOL GLYCEROL × 1 PO4 PHOSPHATE ION × 2 MG MAGNESIUM ION × 7 NA SODIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.25；298 K；100 mM Bis-Tris, pH 7.25, 1350 mM Sodium Potassium Phosphate	Resolution 1.19 Å R-free 0.197
9RT2 NetF - ANTXR2 structure (C4) Deposited 2025-07-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: 12-meric	Chain C1 34–318（285 aa） Chain C2 34–318（285 aa） Chain C3 34–318（285 aa） Chain C4 34–318（285 aa）	Mutation：deleted TM and cytoplasmic domains Mutation：deleted TM and cytoplasmic domains Mutation：deleted TM and cytoplasmic domains Mutation：deleted TM and cytoplasmic domains	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9RT4 NetF - ANTXR2 local refinement focused Deposited 2025-07-02	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C1 34–318（285 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.60 Å
9YKB The von Willebrand factor A domain of human capillary morphogenesis gene II, fused to the 1TEL crystallization chaperone, Ala-Val linker variant, expressed with SUMO tag. Deposited 2025-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 40–217（178 aa）	Mutation：R4A,V67E,K77A,R81A,A82V,C215A	MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.1 M BisTrisPropane, 1.5M Ammonium Sulfate	Resolution 2.50 Å R-free 0.194
9YKB The von Willebrand factor A domain of human capillary morphogenesis gene II, fused to the 1TEL crystallization chaperone, Ala-Val linker variant, expressed with SUMO tag. Deposited 2025-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain C 40–217（178 aa）	Mutation：R4A,V67E,K77A,R81A,A82V,C215A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.1 M BisTrisPropane, 1.5M Ammonium Sulfate	Resolution 2.50 Å R-free 0.194
9YKB The von Willebrand factor A domain of human capillary morphogenesis gene II, fused to the 1TEL crystallization chaperone, Ala-Val linker variant, expressed with SUMO tag. Deposited 2025-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 40–217（178 aa）	Mutation：R4A,V67E,K77A,R81A,A82V,C215A	MG MAGNESIUM ION × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；0.1 M BisTrisPropane, 1.5M Ammonium Sulfate	Resolution 2.50 Å R-free 0.194

13 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ANTR2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain Y； PDBConstruct 6–183； UniProt 35–212

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1t6b
Deposition date deposition_date	2004-05-05
Structure title title	Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor
Keywords keywords	Bacillus Anthracis; Anthrax toxin; X-ray crystallography, MEMBRANE PROTEIN-TOXIN COMPLEX; MEMBRANE PROTEIN/TOXIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	38.04 Å
Radius of gyration Rg (electron density) rg_electron	38.63 Å
Forward intensity I(0) i0	137717000.00
Molecular weight molecular_weight	95270.0 kDa
Excluded volume excluded_volume	119530 Å³
Envelope volume envelope_volume	157730 Å³
Hydration-shell volume shell_volume	37492 Å³
Envelope diameter envelope_diameter	139.2 Å
Shell Rg shell_rg	39.82 Å
Envelope Rg envelope_rg	38.50 Å
Shape Rg shape_rg	38.64 Å
Total Rg total_rg	38.68 Å
Total atoms total_atoms	6713
Residues n_residues	846
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	132.8 Å
Rg (real space) rg_real	38.65 Å
Rg uncertainty (real space) rg_real_error	1.49 Å
I(0) (real space) i0_real	1.3770e+08
I(0) uncertainty (real space) i0_real_error	2.6240e+06
Rg (reciprocal space) rg_reciprocal	38.28 Å
I(0) (reciprocal space) i0_reciprocal	137700000.0000
Solution quality estimate total_estimate	0.7815
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	31.6 Å
Skewness Skewness skewness	0.632
Kurtosis Kurtosis kurtosis	-0.178
Angular range angular_range	— – 0.2100 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	26110000.0000
Real-space data points n_real_points	43
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.679; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.697; Smooth: 0.423

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Protective Antigen
Molecular weight formula_weight	82768.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X
Atom count atom_count	6852

EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG

来源 Source

来源生物 organism	Bacillus anthracis
NCBI Class编号 ncbi_taxonomy_id	1392
宿主生物 host_organism	Bacillus anthracis

Entity 2 Entity 2 polymer

Description description	Anthrax toxin receptor 2
Molecular weight formula_weight	20630.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

GSHMLEDPRGRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSSNGIAA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	TETRAETHYLENE GLYCOL
Molecular weight formula_weight	194.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	139

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1t6bx1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.60 — Anthrax protective antigen C-terminal-like
Superfamily Superfamily superfamily	f.60.1 — Anthrax protective antigen C-terminal-like
Family Family family	f.60.1.1 — Anthrax protective antigen C-terminal-like

Domain ID domain_id	d1t6bx2
Class class	b — All beta proteins
Fold Fold fold	b.179 — Anthrax protective antigen N-terminal-like
Superfamily Superfamily superfamily	b.179.1 — PA14-like
Family Family family	b.179.1.1 — PA14

Domain ID domain_id	d1t6by_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.62 — vWA-like
Superfamily Superfamily superfamily	c.62.1 — vWA-like
Family Family family	c.62.1.1 — Integrin A (or I) domain

CATH v4.4 (5 domains)

Domain ID domain_id	1t6bX01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	182 — Toxin - Anthrax Protective Antigen; domain 1
Homologous superfamily homologous superfamily	10 — Toxin - Anthrax Protective Antigen;domain 1

Domain ID domain_id	1t6bX02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	240 — Protective antigen, heptamerisation domain

Domain ID domain_id	1t6bX03
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	110 —

Domain ID domain_id	1t6bX04
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	810 —

Domain ID domain_id	1t6bY00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	410 — von Willebrand factor, type A domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	88.160 Å
Unit-cell length b length_b	94.118 Å
Unit-cell length c length_c	135.597 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2101
R_work r_work	0.2072
R_free r_free	0.2657

fit	/app/data/saxs_computation/t6/1t6b/1t6b.fit
pddf	/app/data/pr_computation/t6/1t6b/1t6b.pr.out
profile	/app/data/saxs_computation/t6/1t6b/1t6b.dat

Crystal structure of B. anthracis Protective Antigen complexed with human Anthrax toxin receptor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protective Antigen

State in the Current Structure

Other States of the Same Protein in the Database

Anthrax toxin receptor 2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (3 domains)

CATH v4.4 (5 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)