1tzn

Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protective antigen

Bacillus anthracis str.

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Anthrax toxin receptor 2 × 7 （P58335） CALCIUM ION × 14 MAGNESIUM ION × 7	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 14	Anthrax toxin receptor 2 × 7 （P58335） CALCIUM ION × 14 MAGNESIUM ION × 7	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 28	Anthrax toxin receptor 2 × 14 （P58335） CALCIUM ION × 28 MAGNESIUM ION × 14	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 28	Anthrax toxin receptor 2 × 14 （P58335） CALCIUM ION × 28 MAGNESIUM ION × 14	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 28	Anthrax toxin receptor 2 × 14 （P58335） CALCIUM ION × 28 MAGNESIUM ION × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PAG_BACAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–562； UniProt 203–764 Author chain B； PDBConstruct 1–562； UniProt 203–764 Author chain C； PDBConstruct 1–562； UniProt 203–764 Author chain D； PDBConstruct 1–562； UniProt 203–764 Author chain E； PDBConstruct 1–562； UniProt 203–764 Author chain F； PDBConstruct 1–562； UniProt 203–764 Author chain G； PDBConstruct 1–562； UniProt 203–764 Author chain H； PDBConstruct 1–562； UniProt 203–764 Author chain I； PDBConstruct 1–562； UniProt 203–764 Author chain J； PDBConstruct 1–562； UniProt 203–764 Author chain K； PDBConstruct 1–562； UniProt 203–764 Author chain L； PDBConstruct 1–562； UniProt 203–764 Author chain M； PDBConstruct 1–562； UniProt 203–764 Author chain O； PDBConstruct 1–562； UniProt 203–764

Anthrax toxin receptor 2

Homo sapiens

UniProt P58335

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	Protective antigen × 7 （P13423） CALCIUM ION × 14 MAGNESIUM ION × 7	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 14	Protective antigen × 7 （P13423） CALCIUM ION × 14 MAGNESIUM ION × 7	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 28	Protective antigen × 14 （P13423） CALCIUM ION × 28 MAGNESIUM ION × 14	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 28	Protective antigen × 14 （P13423） CALCIUM ION × 28 MAGNESIUM ION × 14	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 28	Protective antigen × 14 （P13423） CALCIUM ION × 28 MAGNESIUM ION × 14	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ANTR2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 1–181； UniProt 38–218 Author chain b； PDBConstruct 1–181； UniProt 38–218 Author chain c； PDBConstruct 1–181； UniProt 38–218 Author chain d； PDBConstruct 1–181； UniProt 38–218 Author chain e； PDBConstruct 1–181； UniProt 38–218 Author chain f； PDBConstruct 1–181； UniProt 38–218 Author chain g； PDBConstruct 1–181； UniProt 38–218 Author chain h； PDBConstruct 1–181； UniProt 38–218 Author chain i； PDBConstruct 1–181； UniProt 38–218 Author chain j； PDBConstruct 1–181； UniProt 38–218 Author chain k； PDBConstruct 1–181； UniProt 38–218 Author chain l； PDBConstruct 1–181； UniProt 38–218 Author chain m； PDBConstruct 1–181； UniProt 38–218 Author chain o； PDBConstruct 1–181； UniProt 38–218

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1tzn
Deposition date deposition_date	2004-07-10
Structure title title	Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor
Keywords keywords	heptamer, TOXIN RECEPTOR-TOXIN COMPLEX; TOXIN RECEPTOR/TOXIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1tzn__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1tzn__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1tzn__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	60.65 Å
Rg (electron density)	60.54 Å
Total Rg	60.77 Å
Atom count	40285
Residues	5131
Excluded volume	716220 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1tzn__assembly_1__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1tzn__assembly_2__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1tzn__assembly_3__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1tzn__assembly_4__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1tzn__assembly_5__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Protective antigen
Molecular weight formula_weight	63019.0 kDa
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,O
Atom count atom_count	80570

TVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIHEKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIILSKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSSTVAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLDTDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPSDPLETTKPDMTLKEALKIAFGFNEPNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNATNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNIDKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISNPNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG

Source Source

Source organism organism	Bacillus anthracis str.
NCBI taxonomy ID ncbi_taxonomy_id	191218
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Anthrax toxin receptor 2
Molecular weight formula_weight	19840.8 kDa
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,o

SCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSC

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	28

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	14

▼

6. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (14 domains)

Domain ID domain_id	d1tzna_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tznb_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tznc_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tznd_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tzne_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tznf_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tzng_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tznh_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tzni_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tznj_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tznk_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tznl_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tznm_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

Domain ID domain_id	d1tzno_
Class class	i — Low resolution protein structures
Fold Fold fold	i.24 — anthrax toxin protective antigen-receptor complex
Superfamily Superfamily superfamily	i.24.1 — anthrax toxin protective antigen-receptor complex
Family Family family	i.24.1.1 — anthrax toxin protective antigen-receptor complex

▶

Unit-cell length a length_a	158.800 Å
Unit-cell length b length_b	158.846 Å
Unit-cell length c length_c	214.084 Å
Unit-cell angle α angle_alpha	69.58 °
Unit-cell angle β angle_beta	69.07 °
Unit-cell angle γ angle_gamma	65.58 °
Molecules per unit cell Z z_pdb	14

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.300 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.3250
R_work r_work	0.3220
R_free r_free	0.3300

Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protective antigen

State in the Current Structure

Other States of the Same Protein in the Database

Anthrax toxin receptor 2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1tzn__assembly_1__model_1

1tzn__assembly_1__model_1 | I(q)

1tzn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (14 domains)

7. Citations (1)

Crystal Structure of the Anthrax Toxin Protective Antigen Heptameric Prepore bound to the VWA domain of CMG2, an anthrax toxin receptor

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protective antigen

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anthrax toxin receptor 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1tzn__assembly_1__model_1

1tzn__assembly_1__model_1 | I(q)

1tzn__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (14 domains)

7. Citations (1)