1uex

Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin

Method: X-RAY DIFFRACTION D_max: 79.4 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

von Willebrand Factor

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 1260–1468	Fragment：A1 domain	bitiscetin alpha chain × 1 bitiscetin beta chain × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.8；283 K；10% PEG 6000, 2% PEG-MME 550, 5% MPD, pH 7.8, VAPOR DIFFUSION, SITTING DROP, temperature 283K	Resolution 2.85 Å R-free 0.276

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1UEX	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1AO3 A3 DOMAIN OF VON WILLEBRAND FACTOR Deposited 1997-07-16	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1686–1872（187 aa） Fragment：A3 DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1M TRIS PH 8.5, 200MM MGCL2, 24% PEG 8K	Resolution 2.20 Å R-free 0.215
1AO3 A3 DOMAIN OF VON WILLEBRAND FACTOR Deposited 1997-07-16	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1686–1872（187 aa） Fragment：A3 DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1M TRIS PH 8.5, 200MM MGCL2, 24% PEG 8K	Resolution 2.20 Å R-free 0.215
1ATZ HUMAN VON WILLEBRAND FACTOR A3 DOMAIN Deposited 1997-08-15	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1685–1873（189 aa） Fragment：A3-DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；24% PEG 3000, 200 MM SODIUM ACETATE, 100 MM TRIS/HCL PH 8.5	Resolution 1.80 Å R-free 0.240
1ATZ HUMAN VON WILLEBRAND FACTOR A3 DOMAIN Deposited 1997-08-15	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1685–1873（189 aa） Fragment：A3-DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；24% PEG 3000, 200 MM SODIUM ACETATE, 100 MM TRIS/HCL PH 8.5	Resolution 1.80 Å R-free 0.240
1AUQ A1 DOMAIN OF VON WILLEBRAND FACTOR Deposited 1997-09-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1261–1468（208 aa） Fragment：A1	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.1M TRIS PH 8.5, 5MM CDCL2, 5% PEG 8K	Resolution 2.30 Å R-free 0.248
1FE8 CRYSTAL STRUCTURE OF THE VON WILLEBRAND FACTOR A3 DOMAIN IN COMPLEX WITH A FAB FRAGMENT OF IGG RU5 THAT INHIBITS COLLAGEN BINDING Deposited 2000-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1683–1874（192 aa） Fragment：COLLAGEN BINDING DOMAIN A3	Non-standard monomer：Yes (specific site not provided by mmCIF)	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CAC CACODYLATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；iso-propanol, MPD, cacodylate, sodium chloride, Tris , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.03 Å R-free 0.264
1FE8 CRYSTAL STRUCTURE OF THE VON WILLEBRAND FACTOR A3 DOMAIN IN COMPLEX WITH A FAB FRAGMENT OF IGG RU5 THAT INHIBITS COLLAGEN BINDING Deposited 2000-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1683–1874（192 aa） Fragment：COLLAGEN BINDING DOMAIN A3	Non-standard monomer：Yes (specific site not provided by mmCIF)	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；iso-propanol, MPD, cacodylate, sodium chloride, Tris , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.03 Å R-free 0.264
1FE8 CRYSTAL STRUCTURE OF THE VON WILLEBRAND FACTOR A3 DOMAIN IN COMPLEX WITH A FAB FRAGMENT OF IGG RU5 THAT INHIBITS COLLAGEN BINDING Deposited 2000-07-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1683–1874（192 aa） Fragment：COLLAGEN BINDING DOMAIN A3	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；iso-propanol, MPD, cacodylate, sodium chloride, Tris , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.03 Å R-free 0.264
1FE8 CRYSTAL STRUCTURE OF THE VON WILLEBRAND FACTOR A3 DOMAIN IN COMPLEX WITH A FAB FRAGMENT OF IGG RU5 THAT INHIBITS COLLAGEN BINDING Deposited 2000-07-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain A 1683–1874（192 aa） Fragment：COLLAGEN BINDING DOMAIN A3 Chain B 1683–1874（192 aa） Fragment：COLLAGEN BINDING DOMAIN A3 Chain C 1683–1874（192 aa） Fragment：COLLAGEN BINDING DOMAIN A3	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 CAC CACODYLATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；iso-propanol, MPD, cacodylate, sodium chloride, Tris , pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.03 Å R-free 0.264
1FNS CRYSTAL STRUCTURE OF THE VON WILLEBRAND FACTOR (VWF) A1 DOMAIN I546V MUTANT IN COMPLEX WITH THE FUNCTION BLOCKING FAB NMC4 Deposited 2000-08-23	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1271–1465（195 aa） Fragment：A1 DOMAIN RESIDUES 507 - 702, OR GLYCOPROTEIN IBA (A\:ALPHA) BINDING DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å R-free 0.207
1IJB The von Willebrand Factor mutant (I546V) A1 domain Deposited 2001-04-25	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1263–1464（202 aa） Fragment：A1 domain	Mutation：I546V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；293 K；PEG 4000, sodium citrate, ammonium acetate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.80 Å R-free 0.208
1IJK The von Willebrand Factor mutant (I546V) A1 domain-botrocetin Complex Deposited 2001-04-26	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1263–1464（202 aa） Fragment：A1 domain	Mutation：I546V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；293 K；PEG 4000, sodium citrate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.279
1M10 Crystal structure of the complex of Glycoprotein Ib alpha and the von Willebrand Factor A1 Domain Deposited 2002-06-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1261–1468（208 aa） Fragment：A1 domain	Mutation：R543Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；PEG 3000, sodium chloride, MES, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.10 Å R-free 0.296
1OAK CRYSTAL STRUCTURE OF THE VON WILLEBRAND FACTOR (VWF) A1 DOMAIN IN COMPLEX WITH THE FUNCTION BLOCKING NMC-4 FAB Deposited 1997-12-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1271–1465（195 aa） Fragment：A1 DOMAIN RESIDUES 507 - 702, OR GLYCOPROTEIN IBA (A\:ALPHA) BINDING DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8；pH 8	Resolution 2.20 Å R-free 0.274
1SQ0 Crystal Structure of the Complex of the Wild-type Von Willebrand Factor A1 domain and Glycoprotein Ib alpha at 2.6 Angstrom Resolution Deposited 2004-03-17	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1259–1472（214 aa） Fragment：A1	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；PEG-3350; potassium thiocyanate, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 2.60 Å R-free 0.239
1U0N The ternary von Willebrand Factor A1-glycoprotein Ibalpha-botrocetin complex Deposited 2004-07-13	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1261–1468（208 aa） Fragment：VWFA 1	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；Sodium citrate, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.95 Å R-free 0.276
2ADF Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody Directed Against the von Willebrand factor A3-Domain Deposited 2005-07-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1683–1874（192 aa） Fragment：A3 domain	Not recorded	ACY ACETIC ACID × 1 SO4 SULFATE ION × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293 K；PEG 8000, ammonium sulphate, acetate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.90 Å R-free 0.220
2MHP Solution structure of the major factor VIII binding region on von Willebrand factor Deposited 2013-12-02	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 766–864（99 aa） Fragment：;domains TIL' and E', UNP residues 766-864 ;	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；298 K；Pressure ambient NMR sample composition 300 mM [U-13C; U-15N] VWF TIL'E'-1, 20 mM sodium phosphate-2, 100 mM sodium chloride-3, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-10% 13C] VWF TIL'E'-4, 20 mM sodium phosphate-5, 100 mM sodium chloride-6, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-15N] VWF TIL'E'-7, 20 mM sodium phosphate-8, 100 mM sodium chloride-9, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-13C; U-15N] VWF TIL'E'-10, 20 mM sodium phosphate-11, 100 mM sodium chloride-12, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-15N] VWF TIL'E'-13, 20 mM sodium phosphate-14, 100 mM sodium chloride-15, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-13C; U-15N] VWF TIL'E'-16, 20 mM sodium phosphate-17, 100 mM sodium chloride-18, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-13C; U-15N] VWF TIL'E'-19, 20 mM sodium phosphate-20, 100 mM sodium chloride-21, 5 mg/mL Pf1 phage-22, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-13C; U-15N] VWF TIL'E'-23, 20 mM sodium phosphate-24, 100 mM sodium chloride-25, 2 % w/v pentaethylene glycol dodecyl ether-26, 50 mM n-hexanol-27, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2MHQ Solution structure of the major factor VIII binding region on von Willebrand factor Deposited 2013-12-02	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 766–864（99 aa） Fragment：;Domains TIL' and E', UNP residues 766-864 ;	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.4；298 K；Pressure ambient NMR sample composition 300 mM [U-13C; U-15N] VWF TIL'E'-1, 20 mM sodium phosphate-2, 100 mM sodium chloride-3, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-10% 13C] VWF TIL'E'-4, 20 mM sodium phosphate-5, 100 mM sodium chloride-6, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-15N] VWF TIL'E'-7, 20 mM sodium phosphate-8, 100 mM sodium chloride-9, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-13C; U-15N] VWF TIL'E'-10, 20 mM sodium phosphate-11, 100 mM sodium chloride-12, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-15N] VWF TIL'E'-13, 20 mM sodium phosphate-14, 100 mM sodium chloride-15, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-13C; U-15N] VWF TIL'E'-16, 20 mM sodium phosphate-17, 100 mM sodium chloride-18, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-13C; U-15N] VWF TIL'E'-19, 20 mM sodium phosphate-20, 100 mM sodium chloride-21, 5 mg/mL Pf1 phage-22, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 mM [U-13C; U-15N] VWF TIL'E'-23, 20 mM sodium phosphate-24, 100 mM sodium chloride-25, 2 % w/v pentaethylene glycol dodecyl ether-26, 50 mM n-hexanol-27, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
3GXB Crystal structure of VWF A2 domain Deposited 2009-04-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1495–1671（177 aa） Fragment：ADAMTS13 cleavage domain, residues 1495-1671	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；277 K；0.1 M Bis-Tris pH 7.2, 0.2 M lithium sulfate, 25 % PEG3350, vapor diffusion, hanging drop, temperature 277K	Resolution 1.90 Å R-free 0.224
3GXB Crystal structure of VWF A2 domain Deposited 2009-04-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1495–1671（177 aa） Fragment：ADAMTS13 cleavage domain, residues 1495-1671	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.2；277 K；0.1 M Bis-Tris pH 7.2, 0.2 M lithium sulfate, 25 % PEG3350, vapor diffusion, hanging drop, temperature 277K	Resolution 1.90 Å R-free 0.224
3HXO Crystal Structure of Von Willebrand Factor (VWF) A1 Domain in Complex with DNA Aptamer ARC1172, an Inhibitor of VWF-Platelet Binding Deposited 2009-06-21	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 1260–1468（209 aa） Fragment：von Willebrand factor (VWF) A1 Domain (residues 1260-1468)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.1；293 K；25% PEG3350, 0.16 M sodium fluoride, pH 7.1, EVAPORATION, temperature 293K	Resolution 2.40 Å R-free 0.274
3HXQ Crystal Structure of Von Willebrand Factor (VWF) A1 Domain in Complex with DNA Aptamer ARC1172, an Inhibitor of VWF-Platelet Binding Deposited 2009-06-21	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 1260–1468（209 aa） Fragment：von Willebrand factor (VWF) A1 Domain (residues 1260-1468)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；293 K；0.2 M NH4Ac, 0.1 M NaAc, 30% PEG4000, pH 4.6, EVAPORATION, temperature 293K	Resolution 2.69 Å R-free 0.279
3PPV Crystal structure of an engineered VWF A2 domain (N1493C and C1670S) Deposited 2010-11-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1488–1674（187 aa） Fragment：VWFA 2 domain, UNP residues 1488-1674	Mutation：N1493C, C1670S	SO4 SULFATE ION × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.2；293 K；0.1M sodium citrate, 1.6M (NH4)2SO4, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.90 Å R-free 0.231
3PPW Crystal structure of the D1596A mutant of an engineered VWF A2 domain (N1493C and C1670S) Deposited 2010-11-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1488–1674（187 aa） Fragment：VWFA 2 domain, UNP residues 1488-1674	Mutation：N1493C, D1596A, C1670S	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.2；293 K；0.1M sodium citrate, 1.6M (NH4)2SO4, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.90 Å R-free 0.226
3PPX Crystal structure of the N1602A mutant of an engineered VWF A2 domain (N1493C and C1670S) Deposited 2010-11-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1488–1674（187 aa） Fragment：VWF A2 domain, UNP residues 1488-1674	Mutation：N1493C, N1602A, C1670S	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.2；293 K；0.1M sodium citrate, 1.6M (NH4)2SO4, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.91 Å R-free 0.237
3PPY Crystal structure of the D1596A/N1602A double mutant of an engineered VWF A2 domain (N1493C and C1670S) Deposited 2010-11-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1488–1674（187 aa） Fragment：VWF A2 domain, UNP residues 1488-1674	Mutation：N1493, D1596A, N1602A, C1670S	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.2；293 K；0.1M sodium citrate, 1.6M (NH4)2SO4, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.232
3ZQK Von Willebrand Factor A2 domain with calcium Deposited 2011-06-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1478–1674（197 aa） Fragment：A2 DOMAIN, RESIDUES 1478-1674	Not recorded	GOL GLYCEROL × 2 CA CALCIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions PROTEIN BUFFER: 0.015 M HEPES PH 7.5, 0.02 M NACL, 0.001 M CACL2. RESERVOIR BUFFER: 0.1 M MMT (PH 4.0-5.5), 0.15 M (NH4)2SO4, 18-23% (W/V) PEG2000 MME.	Resolution 1.70 Å R-free 0.200
3ZQK Von Willebrand Factor A2 domain with calcium Deposited 2011-06-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1478–1674（197 aa） Fragment：A2 DOMAIN, RESIDUES 1478-1674	Not recorded	CA CALCIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions PROTEIN BUFFER: 0.015 M HEPES PH 7.5, 0.02 M NACL, 0.001 M CACL2. RESERVOIR BUFFER: 0.1 M MMT (PH 4.0-5.5), 0.15 M (NH4)2SO4, 18-23% (W/V) PEG2000 MME.	Resolution 1.70 Å R-free 0.200
3ZQK Von Willebrand Factor A2 domain with calcium Deposited 2011-06-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1478–1674（197 aa） Fragment：A2 DOMAIN, RESIDUES 1478-1674	Not recorded	CA CALCIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions PROTEIN BUFFER: 0.015 M HEPES PH 7.5, 0.02 M NACL, 0.001 M CACL2. RESERVOIR BUFFER: 0.1 M MMT (PH 4.0-5.5), 0.15 M (NH4)2SO4, 18-23% (W/V) PEG2000 MME.	Resolution 1.70 Å R-free 0.200
4C29 Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation Deposited 2013-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1264–1471（208 aa） Fragment：RESIDUES 1264-1471	Mutation：YES	ACT ACETATE ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；CRYSTALS OF A1/SS APPEARED IN DROPS CONTAINING 25% PEG3350 AND 0.2 M CALCIUM ACETATE. THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING. CRYSTALS GROWN IN 8 MG/ML PROTEIN, 15% PEG3350, AND 0.2 M CALCIUM ACETATE WERE HARVESTED, AND SOAKED IN THE SAME BUFFER CONTAINING 20% GLYCEROL FOR CRYOPROTECTION., pH 4.6	Resolution 2.20 Å R-free 0.235
4C29 Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation Deposited 2013-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1264–1471（208 aa） Fragment：RESIDUES 1264-1471	Mutation：YES	PEG DI(HYDROXYETHYL)ETHER × 2 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；CRYSTALS OF A1/SS APPEARED IN DROPS CONTAINING 25% PEG3350 AND 0.2 M CALCIUM ACETATE. THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING. CRYSTALS GROWN IN 8 MG/ML PROTEIN, 15% PEG3350, AND 0.2 M CALCIUM ACETATE WERE HARVESTED, AND SOAKED IN THE SAME BUFFER CONTAINING 20% GLYCEROL FOR CRYOPROTECTION., pH 4.6	Resolution 2.20 Å R-free 0.235
4C2A Crystal Structure of High-Affinity von Willebrand Factor A1 domain with R1306Q and I1309V Mutations in Complex with High Affinity GPIb alpha Deposited 2013-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1264–1471（208 aa） Fragment：RESIDUES 1264-1471	Mutation：YES	CAC CACODYLATE ION × 1 ACT ACETATE ION × 1 CA CALCIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；CRYSTALS OF A1/VWD2-GPIBALPA/VWD2 COMPLEX APPEARED IN 12% PEG 8000, 0.1 M SODIUM CACODYLATE PH 6.5, 0.1 M CALCIUM ACETATE, AND 0.4 MG/ML RISTOCETIN (SIGMA-ALDRICH). THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING. CRYSTALS GREW IN 10 MG/ML COMPLEX, 14% PEG8000, 0.2 M CALCIUM ACETATE, 0.1 M SODIUM CACODYLATE, PH 6.5, AND 0.4 MG/ML RISTOCETIN. NEXT WE SOAKED THESE CRYSTALS IN 14% PEG8000, 0.2 M CALCIUM ACETATE, 0.1 SODIUM CACODYLATE, PH 6.5, AND 4 MG/ML RISTOCETIN.	Resolution 2.08 Å R-free 0.189
4C2B Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha Deposited 2013-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1264–1471（208 aa） Fragment：1264-1468	Mutation：YES	SO4 SULFATE ION × 2 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；CRYSTALS OF A1/SS-GPIB/VWD2 COMPLEX APPEARED IN DROPS WITH 20% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING CRYSTAL GROWTH IN 8 MG/ML COMPLEX, 15% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08 M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. SINCE THESE CRYSTALS WERE FORMED IN BUFFER CONTAINING 20% GLYCEROL, NO ADDITIONAL CRYOPROTECTION WAS USED.	Resolution 2.80 Å R-free 0.286
4C2B Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha Deposited 2013-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1264–1471（208 aa） Fragment：1264-1468	Mutation：YES	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；CRYSTALS OF A1/SS-GPIB/VWD2 COMPLEX APPEARED IN DROPS WITH 20% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING CRYSTAL GROWTH IN 8 MG/ML COMPLEX, 15% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08 M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. SINCE THESE CRYSTALS WERE FORMED IN BUFFER CONTAINING 20% GLYCEROL, NO ADDITIONAL CRYOPROTECTION WAS USED.	Resolution 2.80 Å R-free 0.286
4C2B Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha Deposited 2013-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1264–1471（208 aa） Fragment：1264-1468	Mutation：YES	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；CRYSTALS OF A1/SS-GPIB/VWD2 COMPLEX APPEARED IN DROPS WITH 20% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING CRYSTAL GROWTH IN 8 MG/ML COMPLEX, 15% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08 M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. SINCE THESE CRYSTALS WERE FORMED IN BUFFER CONTAINING 20% GLYCEROL, NO ADDITIONAL CRYOPROTECTION WAS USED.	Resolution 2.80 Å R-free 0.286
4C2B Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha Deposited 2013-08-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1264–1471（208 aa） Fragment：1264-1468	Mutation：YES	SO4 SULFATE ION × 4 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；CRYSTALS OF A1/SS-GPIB/VWD2 COMPLEX APPEARED IN DROPS WITH 20% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. THESE CRYSTALS WERE CRUSHED AND USED FOR SEEDING CRYSTAL GROWTH IN 8 MG/ML COMPLEX, 15% PEG 4000, 0.16 M AMMONIUM SULFATE, 0.08 M SODIUM ACETATE, PH 4.6, AND 20% GLYCEROL. SINCE THESE CRYSTALS WERE FORMED IN BUFFER CONTAINING 20% GLYCEROL, NO ADDITIONAL CRYOPROTECTION WAS USED.	Resolution 2.80 Å R-free 0.286
4DMU Crystal structure of the von Willebrand factor A3 domain in complex with a collagen III derived triple-helical peptide Deposited 2012-02-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1683–1874（192 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM cacodylate, pH 6.5, 1.20 M (NH4)2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.253
4DMU Crystal structure of the von Willebrand factor A3 domain in complex with a collagen III derived triple-helical peptide Deposited 2012-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1683–1874（192 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM cacodylate, pH 6.5, 1.20 M (NH4)2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.253
4DMU Crystal structure of the von Willebrand factor A3 domain in complex with a collagen III derived triple-helical peptide Deposited 2012-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1683–1874（192 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM cacodylate, pH 6.5, 1.20 M (NH4)2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.253
4DMU Crystal structure of the von Willebrand factor A3 domain in complex with a collagen III derived triple-helical peptide Deposited 2012-02-08	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1683–1874（192 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM cacodylate, pH 6.5, 1.20 M (NH4)2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.253
4DMU Crystal structure of the von Willebrand factor A3 domain in complex with a collagen III derived triple-helical peptide Deposited 2012-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 1683–1874（192 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM cacodylate, pH 6.5, 1.20 M (NH4)2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.253
4DMU Crystal structure of the von Willebrand factor A3 domain in complex with a collagen III derived triple-helical peptide Deposited 2012-02-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 1683–1874（192 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM cacodylate, pH 6.5, 1.20 M (NH4)2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.253
4NT5 Crystal structure of human von Willebrand factor CTCK domain Deposited 2013-12-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2721–2813（93 aa） Fragment：C-terminal cystine knot domain, unp residues 2721-2813	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ZN ZINC ION × 2 SO4 SULFATE ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；293 K；1.3 M Lithium Sulfate, 0.1 M Bicine, pH 8.3, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.28 Å R-free 0.248
5BV8 G1324S mutation in von Willebrand Factor A1 domain Deposited 2015-06-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1238–1471（234 aa） Fragment：A1 domain (UNP residues 1238-1471)	Mutation：G1324S	EDO 1,2-ETHANEDIOL × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.5；298 K；30% PEG 400, 100 mM CAPS/Sodium hydroxide	Resolution 1.59 Å R-free 0.181
6FWN Structure and dynamics of the platelet integrin-binding C4 domain of von Willebrand factor Deposited 2018-03-06	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2497–2577（81 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 0.04；Pressure 1 NMR sample composition 500 uM [U-13C; U-15N] von Willebrand Factor C4 domain, 20 mM sodium phosphate, 49.5 M H2O, 5.5 M D2O, 0.02 % w/v sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 500 uM [U-13C; U-15N] von Willebrand Factor C4 domain, 20 mM sodium phosphate, 55 M D2O, 5 mM H2O, 0.02 % w/v sodium azide, 100% D2O \| 100% D2O	Resolution not provided
6N29 Crystal structure of monomeric von Willebrand Factor D`D3 assembly Deposited 2018-11-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 764–1244（481 aa）	Mutation：Q852R, C1009A, C1142A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 2 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；297 K；5.5% (w/v) PEG8000, 10% (w/v) PEG1000, 0.2 M calcium acetate and 0.1 M Tris-acetate, pH 8.5	Resolution 2.50 Å R-free 0.241
6N29 Crystal structure of monomeric von Willebrand Factor D`D3 assembly Deposited 2018-11-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 764–1244（481 aa）	Mutation：Q852R, C1009A, C1142A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CA CALCIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；297 K；5.5% (w/v) PEG8000, 10% (w/v) PEG1000, 0.2 M calcium acetate and 0.1 M Tris-acetate, pH 8.5	Resolution 2.50 Å R-free 0.241
7EOW High-resolution structure of vWF A1 domain in complex with caplacizumab, the first nanobody-based medicine Deposited 2021-04-23	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1261–1468（208 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；293.15 K；20 mM Tris-HCl pH 8 150 mM NaCl 10% glycerol 40% glycerol ethoxylate	Resolution 1.60 Å R-free 0.198
7F49 von Willebrand factor (VWF) A1 domain with BT-100 aptamer RNA Deposited 2021-06-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: dimeric	Chain A 1260–1468（209 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.1M Sodium Acetate pH 4.6, 18% w/v PEG 4000	Resolution 2.09 Å R-free 0.239
7P4N NMR solution structure of the C6 domain of von Willebrand Factor Deposited 2021-07-12	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2647–2720（74 aa）	Mutation：G2705R	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 20；Pressure 1.013 NMR sample composition 300 uM [U-13C; U-15N] von Willebrand Factor C6 domain, 20 mM None sodium phosphate, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
7PMV VWF Tubules of D1D2D'D3 domains Deposited 2021-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1241（1241 aa） Chain B 1–1241（1241 aa） Chain D 1–1241（1241 aa） Chain E 1–1241（1241 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 16 CA CALCIUM ION × 12	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7PNF VWF Tubules of D1D2D'D3 domains Deposited 2021-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 36 PDB declaration: 36-meric	Chain B 1–1241（1241 aa） Chain D 1–1241（1241 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 144 CA CALCIUM ION × 108	ELECTRON MICROSCOPY cryo-EM buffer pH 6 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.35 Å
7WN3 Cryo-EM structure of VWF D'D3 dimer (2M mutant) complexed with D1D2 at 3.29 angstron resolution (2 units) Deposited 2022-01-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 23–763（741 aa） Fragment：D1D2 domain Chain B 23–763（741 aa） Fragment：D1D2 domain Chain C 764–1241（478 aa） Fragment：;D'D3 domain ; Chain D 764–1241（478 aa） Fragment：;D'D3 domain ; Chain E 23–763（741 aa） Fragment：D1D2 domain Chain F 764–1241（478 aa） Fragment：;D'D3 domain ; Chain G 23–763（741 aa） Fragment：D1D2 domain Chain H 764–1241（478 aa） Fragment：;D'D3 domain ;	Mutation：R1136M,E1143M Mutation：R1136M,E1143M Mutation：R1136M,E1143M Mutation：R1136M,E1143M	CA CALCIUM ION × 16 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
7WN4 Cryo-EM structure of VWF D'D3 dimer (wild type) complexed with D1D2 at 3.4 angstron resolution (1 unit) Deposited 2022-01-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 23–763（741 aa） Fragment：D1D2 domain Chain F 764–1241（478 aa） Fragment：;D'D3 domain ; Chain G 23–763（741 aa） Fragment：D1D2 domain Chain H 764–1241（478 aa） Fragment：;D'D3 domain ;	Not recorded	CA CALCIUM ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7WN6 Cryo-EM structure of VWF D'D3 dimer (R1136M/E1143M mutant) complexed with D1D2 at 3.29 angstron resolution (2 units) Deposited 2022-01-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 23–763（741 aa） Fragment：D1D2 domain Chain B 23–763（741 aa） Fragment：D1D2 domain Chain C 764–1241（478 aa） Fragment：;D'D3 domain ; Chain D 764–1241（478 aa） Fragment：;D'D3 domain ; Chain E 23–763（741 aa） Fragment：D1D2 domain Chain F 764–1241（478 aa） Fragment：;D'D3 domain ; Chain G 23–763（741 aa） Fragment：D1D2 domain Chain H 764–1241（478 aa） Fragment：;D'D3 domain ;	Mutation：R1136M/E1143M Mutation：R1136M/E1143M Mutation：R1136M/E1143M Mutation：R1136M/E1143M	CA CALCIUM ION × 16 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.29 Å
7WPP Cryo-EM structure of VWF D'D3 dimer complexed with D1D2 at 2.85 angstron resolution (1 unit) Deposited 2022-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 23–763（741 aa） Fragment：D1D2 domain Chain F 764–1241（478 aa） Fragment：;D'D3 domain ; Chain G 23–763（741 aa） Fragment：D1D2 domain Chain H 764–1241（478 aa） Fragment：;D'D3 domain ;	Not recorded	CA CALCIUM ION × 6 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.85 Å
7WPQ Cryo-EM structure of VWF D'D3 dimer complexed with D1D2 at 3.27 angstron resolution (2 units) Deposited 2022-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 8 PDB declaration: octameric	Chain A 23–763（741 aa） Fragment：D1D2 domain Chain B 23–763（741 aa） Fragment：D1D2 domain Chain C 764–1241（478 aa） Fragment：;D'D3 domain ; Chain D 764–1241（478 aa） Fragment：;D'D3 domain ; Chain E 23–763（741 aa） Fragment：D1D2 domain Chain F 764–1241（478 aa） Fragment：;D'D3 domain ; Chain G 23–763（741 aa） Fragment：D1D2 domain Chain H 764–1241（478 aa） Fragment：;D'D3 domain ;	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 20 CA CALCIUM ION × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.27 Å
7WPR VWF D'D3 dimer complexed with D1D2 at 4.39 angstron resolution(VWF tube) Deposited 2022-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 32 PDB declaration: 32-meric	Chain A 23–763（741 aa） Fragment：D1D2 domain Chain B 23–763（741 aa） Fragment：D1D2 domain Chain C 764–1241（478 aa） Fragment：;D'D3 domain ; Chain D 764–1241（478 aa） Fragment：;D'D3 domain ; Chain E 23–763（741 aa） Fragment：D1D2 domain Chain F 23–763（741 aa） Fragment：D1D2 domain Chain G 23–763（741 aa） Fragment：D1D2 domain Chain H 23–763（741 aa） Fragment：D1D2 domain Chain I 23–763（741 aa） Fragment：D1D2 domain Chain J 23–763（741 aa） Fragment：D1D2 domain Chain K 23–763（741 aa） Fragment：D1D2 domain Chain L 23–763（741 aa） Fragment：D1D2 domain Chain M 23–763（741 aa） Fragment：D1D2 domain Chain N 23–763（741 aa） Fragment：D1D2 domain Chain O 23–763（741 aa） Fragment：D1D2 domain Chain P 23–763（741 aa） Fragment：D1D2 domain Chain Q 23–763（741 aa） Fragment：D1D2 domain Chain R 23–763（741 aa） Fragment：D1D2 domain Chain S 764–1241（478 aa） Fragment：;D'D3 domain ; Chain T 764–1241（478 aa） Fragment：;D'D3 domain ; Chain U 764–1241（478 aa） Fragment：;D'D3 domain ; Chain V 764–1241（478 aa） Fragment：;D'D3 domain ; Chain W 764–1241（478 aa） Fragment：;D'D3 domain ; Chain X 764–1241（478 aa） Fragment：;D'D3 domain ; Chain Y 764–1241（478 aa） Fragment：;D'D3 domain ; Chain Z 764–1241（478 aa） Fragment：;D'D3 domain ; Chain a 764–1241（478 aa） Fragment：;D'D3 domain ; Chain b 764–1241（478 aa） Fragment：;D'D3 domain ; Chain c 764–1241（478 aa） Fragment：;D'D3 domain ; Chain d 764–1241（478 aa） Fragment：;D'D3 domain ; Chain e 764–1241（478 aa） Fragment：;D'D3 domain ; Chain f 764–1241（478 aa） Fragment：;D'D3 domain ;	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 42 CA CALCIUM ION × 56	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.39 Å
7WPS Cryo-EM structure of VWF D'D3 dimer complexed with D1D2 at 4.3 angstron resolution (7 units) Deposited 2022-01-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 28 PDB declaration: 28-meric	Chain A 23–763（741 aa） Fragment：D1D2 domain Chain B 23–763（741 aa） Fragment：D1D2 domain Chain C 764–1241（478 aa） Fragment：;D'D3 domain ; Chain D 764–1241（478 aa） Fragment：;D'D3 domain ; Chain E 23–763（741 aa） Fragment：D1D2 domain Chain F 764–1241（478 aa） Fragment：;D'D3 domain ; Chain G 23–763（741 aa） Fragment：D1D2 domain Chain H 764–1241（478 aa） Fragment：;D'D3 domain ; Chain I 23–763（741 aa） Fragment：D1D2 domain Chain J 764–1241（478 aa） Fragment：;D'D3 domain ; Chain K 23–763（741 aa） Fragment：D1D2 domain Chain L 764–1241（478 aa） Fragment：;D'D3 domain ; Chain M 23–763（741 aa） Fragment：D1D2 domain Chain N 764–1241（478 aa） Fragment：;D'D3 domain ; Chain O 23–763（741 aa） Fragment：D1D2 domain Chain P 764–1241（478 aa） Fragment：;D'D3 domain ; Chain Q 23–763（741 aa） Fragment：D1D2 domain Chain R 764–1241（478 aa） Fragment：;D'D3 domain ; Chain S 23–763（741 aa） Fragment：D1D2 domain Chain T 764–1241（478 aa） Fragment：;D'D3 domain ; Chain U 23–763（741 aa） Fragment：D1D2 domain Chain V 764–1241（478 aa） Fragment：;D'D3 domain ; Chain W 23–763（741 aa） Fragment：D1D2 domain Chain X 764–1241（478 aa） Fragment：;D'D3 domain ; Chain Y 23–763（741 aa） Fragment：D1D2 domain Chain Z 764–1241（478 aa） Fragment：;D'D3 domain ; Chain a 23–763（741 aa） Fragment：D1D2 domain Chain b 764–1241（478 aa） Fragment：;D'D3 domain ;	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 42 CA CALCIUM ION × 56	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.32 Å
7WQT Cryo-EM structure of VWF D'D3 dimer complexed with D1D2 at 4.3 angstron resolution (VWF tube) Deposited 2022-01-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 32 PDB declaration: 32-meric	Chain A 23–763（741 aa） Fragment：D1D2 domain Chain B 23–763（741 aa） Fragment：D1D2 domain Chain C 764–1241（478 aa） Fragment：;D'D3 domain ; Chain D 764–1241（478 aa） Fragment：;D'D3 domain ; Chain E 23–763（741 aa） Fragment：D1D2 domain Chain F 23–763（741 aa） Fragment：D1D2 domain Chain G 23–763（741 aa） Fragment：D1D2 domain Chain H 23–763（741 aa） Fragment：D1D2 domain Chain I 23–763（741 aa） Fragment：D1D2 domain Chain J 23–763（741 aa） Fragment：D1D2 domain Chain K 23–763（741 aa） Fragment：D1D2 domain Chain L 23–763（741 aa） Fragment：D1D2 domain Chain M 23–763（741 aa） Fragment：D1D2 domain Chain N 23–763（741 aa） Fragment：D1D2 domain Chain O 23–763（741 aa） Fragment：D1D2 domain Chain P 23–763（741 aa） Fragment：D1D2 domain Chain Q 23–763（741 aa） Fragment：D1D2 domain Chain R 23–763（741 aa） Fragment：D1D2 domain Chain S 764–1241（478 aa） Fragment：;D'D3 domain ; Chain T 764–1241（478 aa） Fragment：;D'D3 domain ; Chain U 764–1241（478 aa） Fragment：;D'D3 domain ; Chain V 764–1241（478 aa） Fragment：;D'D3 domain ; Chain W 764–1241（478 aa） Fragment：;D'D3 domain ; Chain X 764–1241（478 aa） Fragment：;D'D3 domain ; Chain Y 764–1241（478 aa） Fragment：;D'D3 domain ; Chain Z 764–1241（478 aa） Fragment：;D'D3 domain ; Chain a 764–1241（478 aa） Fragment：;D'D3 domain ; Chain b 764–1241（478 aa） Fragment：;D'D3 domain ; Chain c 764–1241（478 aa） Fragment：;D'D3 domain ; Chain d 764–1241（478 aa） Fragment：;D'D3 domain ; Chain e 764–1241（478 aa） Fragment：;D'D3 domain ; Chain f 764–1241（478 aa） Fragment：;D'D3 domain ;	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 42 CA CALCIUM ION × 56	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.30 Å
7ZWH VWF Tubules of D1D2 and D'D3A1 domains Deposited 2022-05-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain D 1–1197（1197 aa） Chain E 1–1197（1197 aa） Chain G 1265–1463（199 aa） Chain H 1265–1463（199 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 CA CALCIUM ION × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 5.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8D3C VWF tubule derived from monomeric D1-A1 Deposited 2022-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 16 PDB declaration: hexadecameric	Chain A 1–1464（1464 aa） Chain B 1–1464（1464 aa） Chain C 1–1464（1464 aa） Chain D 1–1464（1464 aa） Chain E 1–1464（1464 aa） Chain F 1–1464（1464 aa） Chain G 1–1464（1464 aa） Chain H 1–1464（1464 aa） Chain I 1–1464（1464 aa） Chain J 1–1464（1464 aa） Chain K 1–1464（1464 aa） Chain L 1–1464（1464 aa） Chain M 1–1464（1464 aa） Chain N 1–1464（1464 aa） Chain O 1–1464（1464 aa） Chain P 1–1464（1464 aa）	Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA) Mutation：WT VWF Furin cleavage site mutated (760RSKR763->760ASA)	CA CALCIUM ION × 48 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 80	ELECTRON MICROSCOPY cryo-EM buffer pH 5.2；100 mM Sodium Cacodylate at pH 5.2, 10 mM CaCl2, and 100 mM NaCl. cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8D3D VWF tubule derived from dimeric D1-A1 Deposited 2022-06-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 16 PDB declaration: hexadecameric	Chain A 1–1464（1464 aa） Chain B 1–1464（1464 aa） Chain C 1–1464（1464 aa） Chain D 1–1464（1464 aa） Chain E 1–1464（1464 aa） Chain F 1–1464（1464 aa） Chain G 1–1464（1464 aa） Chain H 1–1464（1464 aa） Chain I 1–1464（1464 aa） Chain J 1–1464（1464 aa） Chain K 1–1464（1464 aa） Chain L 1–1464（1464 aa） Chain M 1–1464（1464 aa） Chain N 1–1464（1464 aa） Chain O 1–1464（1464 aa） Chain P 1–1464（1464 aa）	Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA) Mutation：Furin cleavage site mutated (760RSKR->760ASA)	CA CALCIUM ION × 48 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 80	ELECTRON MICROSCOPY cryo-EM buffer pH 5.2；100 mM Sodium Cacodylate at pH 5.2, 10 mM CaCl2, and 100 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

46 other PDB entries and 64 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	VWF_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–209； UniProt 1260–1468

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1uex
Deposition date deposition_date	2003-05-22
Structure title title	Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin
Keywords keywords	C-type lectin heterodimer, TOXIN-BLOOD CLOTTING COMPLEX; TOXIN/BLOOD CLOTTING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	25.41 Å
Radius of gyration Rg (electron density) rg_electron	24.33 Å
Forward intensity I(0) i0	43680900.00
Molecular weight molecular_weight	51859.0 kDa
Excluded volume excluded_volume	65208 Å³
Envelope volume envelope_volume	76716 Å³
Hydration-shell volume shell_volume	26723 Å³
Envelope diameter envelope_diameter	82.8 Å
Shell Rg shell_rg	31.25 Å
Envelope Rg envelope_rg	24.44 Å
Shape Rg shape_rg	24.32 Å
Total Rg total_rg	25.18 Å
Total atoms total_atoms	3651
Residues n_residues	450
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	79.4 Å
Rg (real space) rg_real	25.37 Å
Rg uncertainty (real space) rg_real_error	0.47 Å
I(0) (real space) i0_real	4.3680e+07
I(0) uncertainty (real space) i0_real_error	5.8200e+05
Rg (reciprocal space) rg_reciprocal	25.38 Å
I(0) (reciprocal space) i0_reciprocal	43680000.0000
Solution quality estimate total_estimate	0.9107
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	26.9 Å
Skewness Skewness skewness	0.241
Kurtosis Kurtosis kurtosis	-0.554
Angular range angular_range	— – 0.3100 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	8925000.0000
Real-space data points n_real_points	63
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.952; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.998; Smooth: 0.981

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	bitiscetin alpha chain
Molecular weight formula_weight	14953.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3691

DPGCLPDWSSYKGHCYKVFKKVGTWEDAEKFCVENSGHLASIDSKEEADFVTKLASQTLTKFVYDAWIGLRDESKTQQCSPQWTDGSSVVYENVDEPTKCFGLDVHTEYRTWTDLPCGEKNPFICKSRLPH

Entity 2 Entity 2 polymer

Description description	bitiscetin beta chain
Molecular weight formula_weight	14822.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

DEGCLPDWSSYKGHCYKVFKVEKTWADAEKFCKELVNGGHLMSVNSREEGEFISKLALEKMRIVLVWIGLSHFWRICPLRWTDGARLDYRALSDEPICFVAESFHNKWIQWTCNRKKSFVCKYRV

Entity 3 Entity 3 polymer

Description description	von Willebrand Factor
Molecular weight formula_weight	23889.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

EDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPT

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	40

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1uexa_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d1uexb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.169 — C-type lectin-like
Superfamily Superfamily superfamily	d.169.1 — C-type lectin-like
Family Family family	d.169.1.1 — C-type lectin domain

Domain ID domain_id	d1uexc_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.62 — vWA-like
Superfamily Superfamily superfamily	c.62.1 — vWA-like
Family Family family	c.62.1.1 — Integrin A (or I) domain

CATH v4.4 (3 domains)

Domain ID domain_id	1uexA00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	1uexB00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	100 — Mannose-Binding Protein A; Chain A
Homologous superfamily homologous superfamily	10 — Mannose-Binding Protein A, subunit A

Domain ID domain_id	1uexC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	410 — von Willebrand factor, type A domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	89.282 Å
Unit-cell length b length_b	89.282 Å
Unit-cell length c length_c	53.394 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 43
Space-group number int_tables_number	78
Crystal system crystal_system	—

Resolution resolution	2.850 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	—
R_work r_work	0.1940
R_free r_free	0.2760

fit	/app/data/saxs_computation/ue/1uex/1uex.fit
pddf	/app/data/pr_computation/ue/1uex/1uex.pr.out
profile	/app/data/saxs_computation/ue/1uex/1uex.dat

Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin

1. Protein Identity and Related Structures Protein Identity & Related Structures

von Willebrand Factor

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)