SAXSdb — 2boj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PSEUDOMONAS AERUGINOSA LECTIN II

PSEUDOMONAS AERUGINOSA

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	methyl beta-D-arabinopyranoside × 4 CALCIUM ION × 8 SULFATE ION × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9HYN5_PSEAE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–114； UniProt 2–115 Author chain B； PDBConstruct 1–114； UniProt 2–115 Author chain C； PDBConstruct 1–114； UniProt 2–115 Author chain D； PDBConstruct 1–114； UniProt 2–115

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2boj
Deposition date deposition_date	2005-04-12
Structure title title	crystal Structure of pseudomonas aeruginosa lectin (PA-IIL) complexed with methyl-B-D-Arabinopyranoside
Keywords keywords	LECTIN, ARABINOSE, CALCIUM, LEWIS A, CYSTIC FIBROSIS; LECTIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2boj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2boj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2boj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	22.51 Å
Rg (electron density)	21.00 Å
Total Rg	21.93 Å
Atom count	3365
Residues	456
Excluded volume	59121 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2boj__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	PSEUDOMONAS AERUGINOSA LECTIN II
Molecular weight formula_weight	11734.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	4102

ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG

Source Source

Source organism organism	PSEUDOMONAS AERUGINOSA
NCBI taxonomy ID ncbi_taxonomy_id	208964
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	methyl beta-D-arabinopyranoside
Molecular weight formula_weight	164.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	612

▼

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2boja_
Class class	b — All beta proteins
Fold Fold fold	b.115 — Calcium-mediated lectin
Superfamily Superfamily superfamily	b.115.1 — Calcium-mediated lectin
Family Family family	b.115.1.1 — Calcium-mediated lectin

Domain ID domain_id	d2bojb_
Class class	b — All beta proteins
Fold Fold fold	b.115 — Calcium-mediated lectin
Superfamily Superfamily superfamily	b.115.1 — Calcium-mediated lectin
Family Family family	b.115.1.1 — Calcium-mediated lectin

Domain ID domain_id	d2bojc_
Class class	b — All beta proteins
Fold Fold fold	b.115 — Calcium-mediated lectin
Superfamily Superfamily superfamily	b.115.1 — Calcium-mediated lectin
Family Family family	b.115.1.1 — Calcium-mediated lectin

Domain ID domain_id	d2bojd_
Class class	b — All beta proteins
Fold Fold fold	b.115 — Calcium-mediated lectin
Superfamily Superfamily superfamily	b.115.1 — Calcium-mediated lectin
Family Family family	b.115.1.1 — Calcium-mediated lectin

CATH v4.4 (4 domains)

Domain ID domain_id	2bojA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	400 — Calcium-mediated lectin

Domain ID domain_id	2bojB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	400 — Calcium-mediated lectin

Domain ID domain_id	2bojC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	400 — Calcium-mediated lectin

Domain ID domain_id	2bojD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	400 — Calcium-mediated lectin

▶

Unit-cell length a length_a	50.636 Å
Unit-cell length b length_b	80.168 Å
Unit-cell length c length_c	52.517 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	109.92 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	49.390 Å
R factor r_factor	0.1370
R_work r_work	0.1360
R_free r_free	0.1720

crystal Structure of pseudomonas aeruginosa lectin (PA-IIL) complexed with methyl-B-D-Arabinopyranoside

1. Protein Identity and Related Structures Protein Identity & Related Structures

PSEUDOMONAS AERUGINOSA LECTIN II

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2boj__assembly_1__model_1

2boj__assembly_1__model_1 | I(q)

2boj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (2)

crystal Structure of pseudomonas aeruginosa lectin (PA-IIL) complexed with methyl-B-D-Arabinopyranoside

1. Protein Identity and Related Structures Protein Identity & Related Structures

PSEUDOMONAS AERUGINOSA LECTIN II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2boj__assembly_1__model_1

2boj__assembly_1__model_1 | I(q)

2boj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

7. Citations (2)